PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G165972_P04
Common NameLOC100280131
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family HSF
Protein Properties Length: 175aa    MW: 19553.3 Da    PI: 4.0984
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G165972_P04genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind73.93.1e-2344102260
                        HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
       HSF_DNA-bind   2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 
                        Fl+k+++++ d++++e+isw + gnsfvv+d++ fa  +Lp++Fkh+nf+SFvRQLn+Y
  GRMZM2G165972_P04  44 FLTKTFDLVADPATDEVISWGRAGNSFVVWDPHVFAAVLLPRFFKHNNFSSFVRQLNTY 102
                        9*********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.105.6E-2637103IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467851.21E-2240103IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004157.1E-2440145IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.1E-144467IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004471.6E-2044102IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.1E-148294IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.1E-1495107IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MDLMLPVTVK EEWPPEEEEE EDVDADADAP RPMEGLHEVG PPPFLTKTFD LVADPATDEV  60
ISWGRAGNSF VVWDPHVFAA VLLPRFFKHN NFSSFVRQLN TYVSAPSTLL AQLLSCDFLF  120
LVGFVLARSG FAVHLASCIV EYSSMSYQST SLSLLLLLTE RTSLYIYISI LCDSQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ldu_A4e-18421021878Heat shock factor protein 1
5d5v_D5e-18421022787Heat shock factor protein 1
5d5v_B5e-18421022787Heat shock factor protein 1
5d5u_B5e-18421022787Heat shock factor protein 1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G165972
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G165972_P04
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0630380.0BT063038.2 Zea mays full-length cDNA clone ZM_BFc0018M12 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001146536.14e-71uncharacterized LOC100280131
RefseqXP_008673118.17e-71PREDICTED: uncharacterized protein LOC100280131 isoform X1
SwissprotQ8H7Y67e-55HFA2D_ORYSJ; Heat stress transcription factor A-2d
TrEMBLA0A096STR11e-126A0A096STR1_MAIZE; Uncharacterized protein
STRINGGRMZM2G165972_P021e-70(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22830.12e-36heat shock transcription factor A6B