PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G165972_P03
Common NameLOC100280131
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family HSF
Protein Properties Length: 164aa    MW: 18343.5 Da    PI: 4.5642
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G165972_P03genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind75.11.3e-2344102260
                        HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
       HSF_DNA-bind   2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 
                        Fl+k+++++ d++++e+isw + gnsfvv+d++ fa  +Lp++Fkh+nf+SFvRQLn+Y
  GRMZM2G165972_P03  44 FLTKTFDLVADPATDEVISWGRAGNSFVVWDPHVFAAVLLPRFFKHNNFSSFVRQLNTY 102
                        9********************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.107.3E-2637102IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004156.6E-2740132IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467851.36E-2240102IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004478.1E-2144109IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000569.2E-144467IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000569.2E-148294IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000569.2E-1495107IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MDLMLPVTVK EEWPPEEEEE EDVDADADAP RPMEGLHEVG PPPFLTKTFD LVADPATDEV  60
ISWGRAGNSF VVWDPHVFAA VLLPRFFKHN NFSSFVRQLN TYLDGPGQGM NEATTAYEKE  120
TNCLFVLKIK KTHSFDHHSP PSNILLVASE RSTRTAGSSR TKDS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ldu_A3e-18421021878Heat shock factor protein 1
5d5u_B3e-18421022787Heat shock factor protein 1
5d5v_B3e-18421022787Heat shock factor protein 1
5d5v_D3e-18421022787Heat shock factor protein 1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G165972
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G165972_P03
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0883990.0BT088399.2 Zea mays full-length cDNA clone ZM_BFc0173P10 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001146536.15e-70uncharacterized LOC100280131
SwissprotQ8H7Y65e-54HFA2D_ORYSJ; Heat stress transcription factor A-2d
TrEMBLA0A096STR01e-120A0A096STR0_MAIZE; Uncharacterized protein
STRINGGRMZM2G165972_P022e-69(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22830.12e-36heat shock transcription factor A6B