PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G163427_P01
Common NameLOC103652667, ZEAMMB73_542861, Zm.22400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family GRAS
Protein Properties Length: 765aa    MW: 84654.3 Da    PI: 5.1643
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G163427_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS343.73e-1053847561373
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                        l++ L++cA+ v++gd + a ++L+++++++sp+gd++qRla++f+ +L+arla+++s+ y++l +++ts   ++e l+a++l+  +s ++k
  GRMZM2G163427_P01 384 LRTMLIHCAQSVATGDRRSAAEVLKQIKHHSSPKGDATQRLAHCFAMGLEARLAGTGSQAYQSLMAQHTS---VVEFLKAYSLYMAASCFMK 472
                        5789************************************************************999999...******************* PP

               GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlv 182
                        + ++  N +I +av+g +++Hi+ +++++G+Q+p L++ La R++gpp++R+T+++ p++g   ++++eetg+rL+++A+e+gvpf+f+  +
  GRMZM2G163427_P01 473 VRFIFSNMTICNAVAGRSKLHIVEYGVQHGFQYPGLFHLLARREGGPPEVRVTAIAVPQPGfrPAHQIEETGRRLSNIAREMGVPFKFRG-I 563
                        ************************************************************9*9***************************.7 PP

               GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsle 272
                        a ++e+++ ++L+++p+E+laVn+   + +l+desv ++s  +rd+vL+ +++++P+v+v++  +  ++++ Fl+rf eal ++sa fd+++
  GRMZM2G163427_P01 564 AAKWEAVRAKDLNIDPDEVLAVNSECYIGNLMDESVLVDSpsPRDTVLNNIREMRPNVFVHTVVNGTYGAPFFLTRFREALFFFSAQFDMID 655
                        99*********************************98877779************************************************* PP

               GRAS 273 aklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkd 364
                        a++pr+++er  +Er ++g  + nv+acega+r+er et+++W+ r ++aG++++pl+ +++k  +  +++++ + + ++e++ +l+lgWk+
  GRMZM2G163427_P01 656 ATIPRDNNERLLIERDIFGTFALNVIACEGADRVERPETYKQWQVRNHRAGLRQLPLNPEVVKASRDKVKNYYHRDFLIDEDNRWLLLGWKG 747
                        *************************************************************************999**************** PP

               GRAS 365 rpLvsvSaW 373
                        r L+++S W
  GRMZM2G163427_P01 748 RVLYAMSTW 756
                        ********* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.983358737IPR005202Transcription factor GRAS
PfamPF035141.0E-102384756IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006340anatomyadult vascular leaf
PO:0009025anatomyvascular leaf
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 765 aa     Download sequence    Send to blast
MSATPEDFLG APYLAAPEPF SPSVFLDLPP TPERPDNSDD LVLPYIAQML MEEDIDDKFF  60
YQFPDHPALL TAQQPYAQIL SDSATATATS SSSDSANATS SSSASGTGGN STLSPSSDAP  120
AGWPYDDALD ISHLLRSPTY PATHMMGVGL DDFAELLTPP QGQGEAQRQQ SSLAALSDGA  180
EEEDGSTKAE ATTTFPVGDA DHAALASAFF GAQNGGDTDM LNMAFLKGME EAKKFLPTNN  240
SLLIGLDETS CKSLPKDRYI KPYTAFAATQ VKEEEEHVVV HGNGMPMFGG SRSTNGRVRK  300
NHRAEGDDLE AETGRSSKLM MPEQEETGAN ELYDEIMNCT YEGFMKRMED LRIAMDSESE  360
KSARKVSRKG ARGRQQLVNE VVDLRTMLIH CAQSVATGDR RSAAEVLKQI KHHSSPKGDA  420
TQRLAHCFAM GLEARLAGTG SQAYQSLMAQ HTSVVEFLKA YSLYMAASCF MKVRFIFSNM  480
TICNAVAGRS KLHIVEYGVQ HGFQYPGLFH LLARREGGPP EVRVTAIAVP QPGFRPAHQI  540
EETGRRLSNI AREMGVPFKF RGIAAKWEAV RAKDLNIDPD EVLAVNSECY IGNLMDESVL  600
VDSPSPRDTV LNNIREMRPN VFVHTVVNGT YGAPFFLTRF REALFFFSAQ FDMIDATIPR  660
DNNERLLIER DIFGTFALNV IACEGADRVE RPETYKQWQV RNHRAGLRQL PLNPEVVKAS  720
RDKVKNYYHR DFLIDEDNRW LLLGWKGRVL YAMSTWVAED NKPIF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-383887568374GRAS family transcription factor containing p
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G163427
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G163427_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008677824.10.0PREDICTED: scarecrow-like protein 34
TrEMBLK7U8D60.0K7U8D6_MAIZE; Uncharacterized protein
STRINGGRMZM2G163427_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-148GRAS family protein