PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G162481_P01
Common NameZEAMMB73_265683, Zm.12920
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family WOX
Protein Properties Length: 399aa    MW: 41806.8 Da    PI: 8.8079
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G162481_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox47.23.9e-15119179257
                        T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
           Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                        r+R+t+++eq+ +Le+ F++   +p ++e  ++ k l     + +++V++WFqNrR + ++
  GRMZM2G162481_P01 119 RSRWTPKPEQILILESIFNSgMVNPPKDETVRIRKLLerfgAVGDANVFYWFQNRRSRSRR 179
                        89*****************99*************************************997 PP

2Wus_type_Homeobox106.41.8e-34118181265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        +r+RWtP+peQi iLe++++sG+++P+k+e+ ri++ Le++G+++d+NVfyWFQNr++R+r++q
  GRMZM2G162481_P01 118 VRSRWTPKPEQILILESIFNSGMVNPPKDETVRIRKLLERFGAVGDANVFYWFQNRRSRSRRRQ 181
                        589***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.71E-14114187IPR009057Homeodomain-like
PROSITE profilePS5007111.256115180IPR001356Homeobox domain
SMARTSM003891.2E-6117184IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.7E-8119186IPR009057Homeodomain-like
PfamPF000467.3E-13119179IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009734Biological Processauxin-activated signaling pathway
GO:0048830Biological Processadventitious root development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MSVQVWLSPK RGASLPVFLK LSTSLSIEVE AQTLLPAHLP RSVCATRSCV HSRPHTNFHT  60
NQRFQSEPTL FCRSPPNQQA VDRSMEGSRN SPDRQSSGGS PEERGSGGSG GRGAGEPVRS  120
RWTPKPEQIL ILESIFNSGM VNPPKDETVR IRKLLERFGA VGDANVFYWF QNRRSRSRRR  180
QRQMQAAAAA AATAAAASSA ANSSPGASAT VGLPSGALQY PLVMSGSGTA CQYEQQASSS  240
SSSGSTGGSS LGLFALGAGV PSTGGGFFQE SCGASSPLAT GLMMGDVDRS GGSDDLFAIS  300
RQMGFAAASP VASASVAPPS TTAHHQQYYS CQSPTGTITV FINGVPMEVP SGPIDMRAIF  360
GQDVLLVHST GALLPVDDYG ILTQSLQTGE SYFLVARPT
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G162481
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00330DAPTransfer from AT3G03660Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G162481_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0877860.0BT087786.1 Zea mays full-length cDNA clone ZM_BFb0202I23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001266443.10.0homeobox domain containing protein
SwissprotQ10M291e-101WOX6_ORYSJ; WUSCHEL-related homeobox 6
TrEMBLK7VIN50.0K7VIN5_MAIZE; Putative homeobox DNA-binding domain superfamily protein
STRINGGRMZM2G162481_P020.0(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17810.23e-31WUSCHEL related homeobox 12