PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G161009_P01
Common NamebZIP96, gpm841, ZEAMMB73_201277, Zm.76927
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 324aa    MW: 35325.6 Da    PI: 6.8276
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G161009_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1491.3e-15254297548
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                        +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eNk+Lkk+
  GRMZM2G161009_P01 254 RRQKRMIKNRESAARSRARKQAYTNELENKVFRLEEENKRLKKQ 297
                        79****************************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.3E-14248300No hitNo description
SMARTSM003387.1E-10250306IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.323252297IPR004827Basic-leucine zipper domain
PfamPF001703.8E-13254298IPR004827Basic-leucine zipper domain
CDDcd147078.43E-25254301No hitNo description
SuperFamilySSF579591.13E-10254299No hitNo description
PROSITE patternPS000360257272IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MSSQTGGGKE SDAGPGQHRQ MQSLARQGSL YNLTLDEVQN HLGEPLLSMN FDELLKSVFP  60
DGVDSDGAVT GKPDRTSSLQ RQGSILMPPQ LSKKTVDEVW KGIQGGPETS TVVDGLQRRE  120
RHPTLGEMTL EDFLVKAGVV TEGLVKDSAD FPSNMDTAGS SVVVAAASSL NPGAQWLQQY  180
QQQVLGSQQL SLAGSYMASQ LRPQPLSIAT GATLDSIYSD DQITSPSFGA LSDPQTPGRK  240
RGALGEVVDK VVERRQKRMI KNRESAARSR ARKQAYTNEL ENKVFRLEEE NKRLKKQQEL  300
DEILSSAPPP EPKYQLRRTG SAAF
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.769270.0leaf| meristem| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G161009
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in embryo during the latest stages of seed maturation. {ECO:0000269|PubMed:15642716}.
UniprotTISSUE SPECIFICITY: Predominantly expressed in seeds. {ECO:0000269|PubMed:12376636}.
Functional Description ? help Back to Top
Source Description
UniProtBinds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G161009_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0613450.0BT061345.1 Zea mays full-length cDNA clone ZM_BFb0137L05 mRNA, complete cds.
GenBankEU9663890.0EU966389.1 Zea mays clone 294076 bZIP transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001150281.10.0uncharacterized protein LOC100283911
SwissprotQ9LES33e-83AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLB6TN240.0B6TN24_MAIZE; BZIP transcription factor
STRINGGRMZM2G161009_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27073883
Representative plantOGRP5401580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.13e-81ABA-responsive element binding protein 3
Publications ? help Back to Top
  1. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]
  2. Kim H, et al.
    ABA-HYPERSENSITIVE BTB/POZ PROTEIN 1 functions as a negative regulator in ABA-mediated inhibition of germination in Arabidopsis.
    Plant Mol. Biol., 2016. 90(3): p. 303-15
    [PMID:26667153]
  3. Song C,Kim T,Chung WS,Lim CO
    The Arabidopsis Phytocystatin AtCYS5 Enhances Seed Germination and Seedling Growth under Heat Stress Conditions.
    Mol. Cells, 2017. 40(8): p. 577-586
    [PMID:28756655]