PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G159475_P01
Common Namegpm542a
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family GRAS
Protein Properties Length: 710aa    MW: 78391.5 Da    PI: 5.1754
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G159475_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS359.54.8e-1103307011373
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                        l++lL++cA+av+s+d + a++lL++++++asp gd++qRla++f+e+L+arla+++s +y++l +++ts    ++ l+a++l+  +  + k
  GRMZM2G159475_P01 330 LRTLLTHCAQAVASDDRRSATELLKQIKQHASPLGDATQRLAHCFAEGLQARLAGTGSMVYQSLMAKRTS---ATDILQAYQLYMAAICFKK 418
                        6789************************************************************999998...99***************** PP

               GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlv 182
                        +  l  N++I++a  g++++Hi+D++i++G+QWp++l+ +a+R++gpp++RiTg++ p++g   ++++eetg+rL+k+A+++gvpf++++++
  GRMZM2G159475_P01 419 VVCLFSNHTIYNAGLGKKKIHIVDYGIQYGFQWPCFLRWIADREGGPPEVRITGIDLPQPGfrPTQRIEETGRRLSKYAQQFGVPFKYQAIA 510
                        ************************************************************9******************************* PP

               GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                        a+++e++++e+L+++p+E+l+Vn+ +q ++l+desv +es+rd vL+ +++++P+ ++++  + + +++ F++rf eal +ysalfd+l+a+
  GRMZM2G159475_P01 511 ASKMESIRVEDLNLDPEEVLIVNCLYQFKNLMDESVVIESPRDIVLNNIRNMRPHTFIHAIVNGSFSAPFFVTRFREALFFYSALFDALDAT 602
                        ******************************************************************************************** PP

               GRAS 275 lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrp 366
                         pr+s++r+ +E+ l+gr++ nv+aceg++r+er et+++W+ r ++aG+k+ pl+ ++++ ++  ++ ++ + + ++ ++ +l++gWk+r 
  GRMZM2G159475_P01 603 TPRDSNQRMLIEENLFGRAALNVIACEGTDRVERPETYKQWQVRNQRAGLKQQPLNPDVVQVVRNKVKDCYHKDFVIDVDHRWLLQGWKGRI 694
                        ***********************************************************************889****************** PP

               GRAS 367 LvsvSaW 373
                        L++vS W
  GRMZM2G159475_P01 695 LYAVSTW 701
                        ******* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.976304682IPR005202Transcription factor GRAS
PfamPF035141.7E-107330701IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 710 aa     Download sequence    Send to blast
MGSSCDPSPS PGADDLFLSL SDLGPTSPSA YLDLPPTPQP QQGIKGPTQD LLLPYISSML  60
MEDDIDDTFF YDYPDNPALL QAQQSFLDVL SDDATVPTTT TTHSSASVNH HHSSSSSDAS  120
ASGPLTPAAV DSYAPAPAAQ FDSFDFDPAA FFSNGANSDL MTSAFLKGME EANKFLPTQD  180
KLVIDLDPPD DPKRFVLPTP AADKLAPGLN AAAPTVHVAV AVKEEEAILA APDAAPGSGG  240
AVLGRGRRNR FDDEEDLELQ RRSSKQSALE GDGDERDVFE KYIIASPEMC TEQMQKLRIA  300
MQEAAAKREA AAGENGKAKG RRGGREVVDL RTLLTHCAQA VASDDRRSAT ELLKQIKQHA  360
SPLGDATQRL AHCFAEGLQA RLAGTGSMVY QSLMAKRTSA TDILQAYQLY MAAICFKKVV  420
CLFSNHTIYN AGLGKKKIHI VDYGIQYGFQ WPCFLRWIAD REGGPPEVRI TGIDLPQPGF  480
RPTQRIEETG RRLSKYAQQF GVPFKYQAIA ASKMESIRVE DLNLDPEEVL IVNCLYQFKN  540
LMDESVVIES PRDIVLNNIR NMRPHTFIHA IVNGSFSAPF FVTRFREALF FYSALFDALD  600
ATTPRDSNQR MLIEENLFGR AALNVIACEG TDRVERPETY KQWQVRNQRA GLKQQPLNPD  660
VVQVVRNKVK DCYHKDFVID VDHRWLLQGW KGRILYAVST WVANDAPSYI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-403307015374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.43910.0ear| endosperm| meristem| ovary
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G159475
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G159475_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7277580.0KJ727758.1 Zea mays clone pUT5702 GRAS transcription factor (GRAS50) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002442368.10.0hypothetical protein SORBIDRAFT_08g018940
TrEMBLA0A096SPI30.0A0A096SPI3_MAIZE; Uncharacterized protein
STRINGGRMZM2G159475_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-155GRAS family protein