PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G159134_P03
Common NameLOC100501609
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 333aa    MW: 36247.5 Da    PI: 7.2606
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G159134_P03genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_151.42.3e-16263311554
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                        +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eNk+L  +l+el++
  GRMZM2G159134_P03 263 RRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEENKKLT-TLKELEN 311
                        79*************************************998.8888876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.2E-11259327IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.128261303IPR004827Basic-leucine zipper domain
PfamPF001701.7E-13263307IPR004827Basic-leucine zipper domain
CDDcd147071.82E-21263309No hitNo description
Gene3DG3DSA:1.20.5.1701.3E-14263311No hitNo description
SuperFamilySSF579593.81E-11263305No hitNo description
PROSITE patternPS000360266281IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MGSQTIASQA GGGGRGMGSS GGAGAAQRGQ MQSLARQGSL YNLTLDEVQS HLGEPLHSMN  60
LEELLKSVFP DDLDPDGGTT SQYEQSSGLL RQGSITMPPE LSRRTVDEVW KDIQDAPNRN  120
VGESGRRKRE RQPTLGEMTL EDFLVKAGVV AEGYLKDLNG IGSVEQVGST GAAGLTAGAQ  180
WLDHYQQRIT AIEPHQHRQH SLPGAYIPGQ LSLQSLNVGP SAILESYSDG HISSPMMGAL  240
SDSPMPGRKR GSPGDVADKL VERRQKRMIK NRESAARSRA RKQAYTNELE NKVSRLEEEN  300
KKLTTLKELE NILFSEPLPE PKYQLRRTGS ATF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1124131GRRKRERQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.865580.0meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G159134
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in embryo during the latest stages of seed maturation. {ECO:0000269|PubMed:15642716}.
UniprotTISSUE SPECIFICITY: Predominantly expressed in seeds. {ECO:0000269|PubMed:12376636}.
Functional Description ? help Back to Top
Source Description
UniProtBinds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00409DAPTransfer from AT3G56850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G159134_P03
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0857580.0BT085758.1 Zea mays full-length cDNA clone ZM_BFc0058B21 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001183222.10.0uncharacterized LOC100501609
SwissprotQ9LES31e-80AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLC4J4L10.0C4J4L1_MAIZE; ABSCISIC ACID-INSENSITIVE 5-like protein 2
STRINGGRMZM2G159134_P020.0(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.19e-72ABA-responsive element binding protein 3
Publications ? help Back to Top
  1. Kim H, et al.
    ABA-HYPERSENSITIVE BTB/POZ PROTEIN 1 functions as a negative regulator in ABA-mediated inhibition of germination in Arabidopsis.
    Plant Mol. Biol., 2016. 90(3): p. 303-15
    [PMID:26667153]
  2. Song C,Kim T,Chung WS,Lim CO
    The Arabidopsis Phytocystatin AtCYS5 Enhances Seed Germination and Seedling Growth under Heat Stress Conditions.
    Mol. Cells, 2017. 40(8): p. 577-586
    [PMID:28756655]