PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G158313_P01
Common NameZm.18102
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 252aa    MW: 26983.2 Da    PI: 5.9639
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G158313_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1301.1e-09118159445
                        XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaL 45 
                         kr +r   NR +A+rsR RK+++i eLe+ v  L+ e +aL
  GRMZM2G158313_P01 118 PKRVKRILANRQSAQRSRVRKLQYISELERSVTGLQMEVSAL 159
                        5999****************************9998887665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.3E-13115179IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.461117173IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.9E-11119173No hitNo description
PfamPF001701.8E-9119168IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.2E-13119173No hitNo description
CDDcd147032.67E-22120170No hitNo description
PROSITE patternPS000360122137IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MAQLPPRAPG GAAPQDHWSA AGEFLGFAAA RRGAHRRSAS DSAAFLEALP MEDVIGGDGF  60
DRLDDDQLMS MFSDVDAPAV SAGDAAQLMD VADADADADD DGSAASSRAA ADGVAADPKR  120
VKRILANRQS AQRSRVRKLQ YISELERSVT GLQMEVSALS PRVAFLDHQR SLLTVGNSHL  180
KQRIAALAQD KIFKDAHQEA LKKEIERLRH VYQQQQQQQQ IKVATTGGAD IAAAASMQAR  240
QELLACEGAA IR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.181020.0ovary| pollen
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G158313
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots and shoots. {ECO:0000269|PubMed:18065552}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription regulator. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G158313_P01
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By white light. {ECO:0000269|PubMed:18065552}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9687450.0EU968745.1 Zea mays clone 323889 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001337114.11e-178uncharacterized protein LOC100281364
SwissprotQ6K3R91e-96BZP19_ORYSJ; Basic leucine zipper 19
TrEMBLA0A1D6H5N51e-177A0A1D6H5N5_MAIZE; Basic leucine zipper 34
STRINGGRMZM2G158313_P011e-178(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132238125
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.11e-51bZIP family protein