PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G157722_P02
Common NameLOC100216617, ZEAMMB73_720644
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 346aa    MW: 36432.1 Da    PI: 5.6153
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G157722_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.59e-16278321548
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                        +r+rr++kNRe+A rsR+RK+a++ eLe +v++L+++N +L+k+
  GRMZM2G157722_P02 278 RRQRRMIKNRESAARSRARKQAYTMELEAEVQKLKEQNAELQKK 321
                        79************************************999865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.3E-12274340IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.093276321IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.81E-11278321No hitNo description
CDDcd147072.56E-25278330No hitNo description
Gene3DG3DSA:1.20.5.1702.2E-15278321No hitNo description
PfamPF001708.5E-13278321IPR004827Basic-leucine zipper domain
PROSITE patternPS000360281296IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MDLNECERRG PAGPDPLSRQ GSIYSLTFDE FQNTLGGMGG GLGKDFGSMN MDELLRSIWT  60
AEESQAMASA SASASASVSA LGAAVDGGAA LQRQGSLALP RTLSVKTVDE VWRDFVREAP  120
PGTAGGEEPQ PNRQPTLGEM TLEEFLVRAG VVRDNPAAAA AAVPAQPVAP RPIQAVSNGA  180
SIFFGNFGGA NDAGAGAMVF APVGIGDQAM GNGLMPGVAG MAGGAVTVSP VDTSVAQLDS  240
MGKSDEDLSS PMAPVPYPFE GVIRGRRSGA GVEKVVERRQ RRMIKNRESA ARSRARKQAY  300
TMELEAEVQK LKEQNAELQK KQVPELVSNP YAQKKRCLRR TLTGPW
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.989600.0ovary
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G157722
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, leaves and embryos. {ECO:0000269|PubMed:10611387}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that mediates abscisic acid (ABA) signaling. Binds specifically to the ABA-responsive element (ABRE) of the EMP1 and RAB16A gene promoters. {ECO:0000269|PubMed:10611387}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G157722_P02
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (ABA). {ECO:0000269|PubMed:10611387}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0396520.0BT039652.1 Zea mays full-length cDNA clone ZM_BFc0037E11 mRNA, complete cds.
GenBankEU9647680.0EU964768.1 Zea mays clone 281458 bZIP transcription factor ABI5 mRNA, complete cds.
GenBankKJ7269430.0KJ726943.1 Zea mays clone pUT3489 bZIP transcription factor (bZIP68) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001353894.10.0uncharacterized protein LOC100216617
SwissprotQ6ZDF31e-140TRAB1_ORYSJ; bZIP transcription factor TRAB1
TrEMBLA0A1D6PZD10.0A0A1D6PZD1_MAIZE; ABSCISIC ACID-INSENSITIVE 5-like protein 5
STRINGGRMZM2G157722_P010.0(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19290.14e-35ABRE binding factor 4
Publications ? help Back to Top
  1. Kagaya Y,Hobo T,Murata M,Ban A,Hattori T
    Abscisic acid-induced transcription is mediated by phosphorylation of an abscisic acid response element binding factor, TRAB1.
    Plant Cell, 2002. 14(12): p. 3177-89
    [PMID:12468735]
  2. Kobayashi Y, et al.
    Abscisic acid-activated SNRK2 protein kinases function in the gene-regulation pathway of ABA signal transduction by phosphorylating ABA response element-binding factors.
    Plant J., 2005. 44(6): p. 939-49
    [PMID:16359387]
  3. Kobayashi F,Maeta E,Terashima A,Takumi S
    Positive role of a wheat HvABI5 ortholog in abiotic stress response of seedlings.
    Physiol Plant, 2008. 134(1): p. 74-86
    [PMID:18433415]