PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G153754_P01
Common NameLOC103632001, Zm.133355
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family CPP
Protein Properties Length: 800aa    MW: 84980.7 Da    PI: 6.4467
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G153754_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.63.8e-16480518240
                TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                         +k+C+CkkskClk+YCeCfaag++Cse C+C++C+Nk 
  GRMZM2G153754_P01 480 ACKRCSCKKSKCLKLYCECFAAGVYCSEPCSCQGCMNKP 518
                        589**********************************96 PP

2TCR49.96.4e-16565603139
                TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                        ++k+gCnCkks+ClkkYCeC++ g+ Cs++C+Ce+CkN 
  GRMZM2G153754_P01 565 RHKRGCNCKKSSCLKKYCECYQGGVGCSSNCRCESCKNA 603
                        589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.2E-17479520IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.188480605IPR005172CRC domain
PfamPF036387.5E-12482517IPR005172CRC domain
SMARTSM011141.2E-15565606IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.4E-11567603IPR005172CRC domain
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 800 aa     Download sequence    Send to blast
MDTPDRAAAQ SAATRTEDSP VFSFLNNLSP IEPLRSSAYS TNSLQGFQSI NITSISSIFT  60
SPHDNVSKEP RLPKSPLGEI SDKEVRADAA GTNEPPEPSN AARLFACTST VTRETRTGTC  120
TGVAGPPPTT GGPCDLALPR QFDNNGSPDH NTTPCHGVRS DLKQDKARKL LQAAQNAKKN  180
ALEKRKCLFS TEVRLLDGGG GGGGEPGSDS DGVLGCEWSD LVSPTSAKLL AFDATMDEHH  240
RGVHLAAQNA ESCGYLLSKL AGDGGVSDGA YPTASAQVYY QELVMGEDQS ENAAPQMDAQ  300
ETISAEETQD NIYEADVCVP LEYKVVESQQ QRGIRRRCLV FEAAGGFSNS AVKRGTIEDR  360
SVSTCSKGKS PAESQPRGLR GIGLHLNALA LTPKGKMACQ DPPPTASALL PSSASEKDAR  420
GELLCAGENF AHSGGELLEF PLDGCSAGGG FPVNDHHVSG QSVSPQKKRR KTDNGDDGEA  480
CKRCSCKKSK CLKLYCECFA AGVYCSEPCS CQGCMNKPIH EETVLSTRKQ IEFRNPLAFA  540
PKVIRMSDAG LETGEDPNNT PASARHKRGC NCKKSSCLKK YCECYQGGVG CSSNCRCESC  600
KNAFGRRDAE TELPEEMKQE ESDQTENPQQ EKENDQQKAN VQGEDHPLLD LVPITPPFDF  660
CSSLLKLPNF SSAKPPRPTK ARSVTSRSSA SKATAAVQPC RSSKLAASAS ASGIDEETPD  720
ILHEPDSLSN CVKTTTSPNG KRVSPPHNAL GSSPNRKGGR KLILKSIPLF PSLTGDTNSG  780
SAMNSTDSAF CASPLTLGPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-1548460214120Protein lin-54 homolog
5fd3_B2e-1548460214120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1466470KKRRK
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G153754
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G153754_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9709800.0EU970980.1 Zea mays clone 355206 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008652082.10.0protein tesmin/TSO1-like CXC 3
TrEMBLA0A1D6HTF10.0A0A1D6HTF1_MAIZE; Protein tesmin/TSO1-like CXC 2
STRINGGRMZM2G153754_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61473447
Representative plantOGRP9931755
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.12e-76TESMIN/TSO1-like CXC 2