PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G152661_P01
Common NameZEAMMB73_276194, Zm.145465
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family CAMTA
Protein Properties Length: 865aa    MW: 97516.4 Da    PI: 7.6971
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G152661_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1612.2e-1919723790
               CG-1 37 gsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahsee 90
                       gsl+Lynr++ ryfr+DG++w++kkdg+tv E+he+LK      l+++  hs++
  GRMZM2G152661_P01 19 GSLFLYNRRVNRYFRRDGHTWRRKKDGRTVGEAHERLKFFVHVFLQTWSKHSHR 72
                       9*************************************8776666666666655 PP

2CG-155.89.1e-1814518775117
               CG-1  75 vggvevlycyYahseenptfqrrcywlLeeelekivlvhylev 117
                        vg+v++l+cyYah+e+np+fqrrc+w+Le ++e+ivlv+y+ev
  GRMZM2G152661_P01 145 VGNVDALSCYYAHGEQNPSFQRRCFWMLEPAYEHIVLVQYREV 187
                        99***************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143744.7251193IPR005559CG-1 DNA-binding domain
SMARTSM010763.3E-93188IPR005559CG-1 DNA-binding domain
PfamPF038591.6E-131972IPR005559CG-1 DNA-binding domain
PfamPF038597.3E-13144186IPR005559CG-1 DNA-binding domain
Gene3DG3DSA:2.60.40.103.1E-6474565IPR013783Immunoglobulin-like fold
SuperFamilySSF812962.24E-13481564IPR014756Immunoglobulin E-set
PfamPF018331.5E-6482554IPR002909IPT domain
SuperFamilySSF484031.59E-7511609IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484031.59E-7668724IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.202.2E-5675723IPR020683Ankyrin repeat-containing domain
PROSITE profilePS502979.596677722IPR020683Ankyrin repeat-containing domain
CDDcd002042.80E-4682722No hitNo description
SMARTSM000153.7E-6740762IPR000048IQ motif, EF-hand binding site
PROSITE profilePS5009610.731741769IPR000048IQ motif, EF-hand binding site
PfamPF006122.1E-5742762IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 865 aa     Download sequence    Send to blast
MGFNRILTNG APIGLFFGGS LFLYNRRVNR YFRRDGHTWR RKKDGRTVGE AHERLKFFVH  60
VFLQTWSKHS HRKQGRCRIP WPRVIVPNCG SGSPWVIVPN ARESLLQHSH DARTCVSVGQ  120
VEFHGCFRLS QMNAYYGALG AFGQVGNVDA LSCYYAHGEQ NPSFQRRCFW MLEPAYEHIV  180
LVQYREVDVV RNYSSQLSNG LPEPLSSLGY PNAICGNQYH SSSSGASECS ESHQSYSNLS  240
SVTEVSSYSG NKEYTKNDGG LLSIPEVGHT CLQQNRTDNG NSKNKSGLNI ALKKIAEQLS  300
LGEDDDDYIF SNQAHSVGGD NQVKHIQQEG TQKGLSRNIA PSWEDVLQSS SGLPISSIYQ  360
QSDVEYQKNS EYHPPERLDS SDLRIQLAAA KKFLLGPEAT VDSPSLNSVL RNRANCVTDT  420
ISAYDSRFGS SLNPDWQTKT ALTFQSNSQG SEITELFDHG HFEHYSREDT TFSLGQTNKF  480
NIREISPEWA FSYEITKVII TGDFLCNPSN LGWAVMFGDS EVPAKVVQPG VLLCHTPLHC  540
SGNLRICITS GNREVCSEFK DFEFRSKPSS SFTDIAPSSR HLKSSEELLI LAKFARMLLS  600
GNGNPEVPDG DPQSGQCPKL KMDEGLWDRL IEELKVGCES PLSSVDWILE ELLKSKLQKW  660
LSVKLRGFNG TDSISKHDQG IIHLISALGY EWALSSVLSV GVGLNFRDSN GWTALHWAAY  720
FGSCSFRRNT KVAKVATFLN MRRNAVKIQA HVRGHQVRKK YRTIVSTVSV LEKVILRWRR  780
KGHGLRGFRA EQQSMVEAIE EDDEEDDDFD DDEAVKIFRR QKVDQAVKEA VSRVLSMVDS  840
TEARMQYRRM LEEFRQATNW KDQMK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.279740.0embryo| tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G152661
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G152661_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008664138.10.0PREDICTED: calmodulin-binding transcription activator 4-like
TrEMBLK7UHS70.0K7UHS7_MAIZE; Uncharacterized protein
STRINGGRMZM2G152661_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5621565
MonocotsOGMP62383241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67310.16e-58Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains