PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G151295_P02
Common NamebZIP124, ZEAMMB73_998179, Zm.19696
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 353aa    MW: 38050.5 Da    PI: 6.5956
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G151295_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.67.5e-10157204552
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                        kr++r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l   
  GRMZM2G151295_P02 157 KRAKRILANRQSAARSKERKARYITELERKVQTLQTEATTLSAQLTLF 204
                        9****************************************9888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-14153217IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.599155218IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.14E-11157208No hitNo description
PfamPF001701.5E-8157202IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.8E-8157202No hitNo description
CDDcd147032.60E-22158207No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009025anatomyvascular leaf
PO:0009074anatomystyle
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0025142anatomyleaf tip
PO:0001007developmental stagepollen development stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001180developmental stageplant proembryo stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MQQQPEPADP PGRALPPPAV PAPAPAPVAA RAAHHRRARS EVAFRLPDDL GLGGGGGPDG  60
DTFDDIGSED DLFSTFMDIE KISSSGPSDR DRAAETSSPP RPKHRHSSSV DGSGLFFSPG  120
IGGGAGKDAA ASLAEVMEAK KAMTPEQLAE LAAIDPKRAK RILANRQSAA RSKERKARYI  180
TELERKVQTL QTEATTLSAQ LTLFQRDTTG LSAENAELKI RLHAMEQQAQ LRDALNDALK  240
QELERLKLVT GEMTNSSETY NMRFQHIPYN SSFFPLSQQN ASPHPGTTQL PPPFHPPHPN  300
VPNHQMLSHP NTLPDIMQQE SLGRLQGLDI GKGPLVVKSE SSSISASESS STF
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.262440.0meristem| pollen| tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G151295
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed at high levels in roots, low level in leaf sheath, but not in leaf blade. Predominantly expressed in vascular tissues. {ECO:0000269|PubMed:14704272}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication. {ECO:0000269|PubMed:14704272}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G151295_P02
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0332100.0BT033210.1 Zea mays full-length cDNA clone ZM_BFb0176L19 mRNA, complete cds.
GenBankBT0632630.0BT063263.1 Zea mays full-length cDNA clone ZM_BFc0045A20 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001130089.10.0uncharacterized protein LOC100191182
SwissprotQ6S4P41e-167RF2B_ORYSJ; Transcription factor RF2b
TrEMBLB4F7X20.0B4F7X2_MAIZE; BZIP transcription factor
STRINGGRMZM2G151295_P020.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26833683
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.11e-68bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Dai S,Zhang Z,Bick J,Beachy RN
    Essential role of the Box II cis element and cognate host factors in regulating the promoter of Rice tungro bacilliform virus.
    J. Gen. Virol., 2006. 87(Pt 3): p. 715-22
    [PMID:16476995]
  3. Liu Y,Dai S,Beachy RN
    Role of the C-terminal domains of rice (Oryza sativa L.) bZIP proteins RF2a and RF2b in regulating transcription.
    Biochem. J., 2007. 405(2): p. 243-9
    [PMID:17371296]
  4. Dai S, et al.
    Transgenic rice plants that overexpress transcription factors RF2a and RF2b are tolerant to rice tungro virus replication and disease.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(52): p. 21012-6
    [PMID:19104064]