PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G148074_P01
Common NameLOC103637666, Zm.21240
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family HD-ZIP
Protein Properties Length: 319aa    MW: 34572.9 Da    PI: 8.5012
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G148074_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.21.6e-19173227256
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        rk+ +++k+q  +Lee F+++++++ ++++ LAk+l+L+ rqV vWFqNrRa+ k
  GRMZM2G148074_P01 173 RKKLRLSKDQAAVLEESFKEHNTLNPKQKAALAKQLNLKPRQVEVWFQNRRARTK 227
                        788899***********************************************98 PP

2HD-ZIP_I/II127.17.8e-41173260188
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                        +kk+rlsk+q+++LEesF+e+++L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL++ev+eLr
  GRMZM2G148074_P01 173 RKKLRLSKDQAAVLEESFKEHNTLNPKQKAALAKQLNLKPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCETLTEENRRLQREVAELR 260
                        69*************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046182.5E-2220145IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466895.85E-19156230IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.3E-20157223IPR009057Homeodomain-like
PROSITE profilePS5007117.281169229IPR001356Homeobox domain
SMARTSM003894.0E-17171233IPR001356Homeobox domain
CDDcd000863.79E-17173230No hitNo description
PfamPF000467.2E-17173227IPR001356Homeobox domain
PROSITE patternPS000270204227IPR017970Homeobox, conserved site
PfamPF021836.2E-10229260IPR003106Leucine zipper, homeobox-associated
SMARTSM003406.2E-22229272IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MDIMALNARD EEQYGNNHLG LGLSLSLGLG VATAAPVEVE PPPPPRQQQQ RAISVAPITS  60
LPAPQWWKWN GPGLFFGTTM DQQQQPAAAR HGHEMPFLRG VDVNRAPAGD TRRGSCSEDD  120
EEPGGASSSP NSTLSSSLSG KRAAPARSGG EVADHTPRAG GGSDDEDSGG GSRKKLRLSK  180
DQAAVLEESF KEHNTLNPKQ KAALAKQLNL KPRQVEVWFQ NRRARTKLKQ TEVDCEFLKR  240
CCETLTEENR RLQREVAELR VLKLVAPHHY ARMPPPTTLT MCPSCERLAS ASASADQAGR  300
AGPCWGPLPV FVDGPARRP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1171177SRKKLRL
2221229RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.212400.0meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G148074
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in root provascular and vascular cylinder, provascular and vascular strands of leaves, provascular and vascular strands of the whole panicle, in mature embryo provascular bundles of scutellum and embryonic axis and provascular and vascular strands of young immature spikelet organs. Expressed in differentiating and differentiated xylem and phloem elements, and in outer and inner bundle sheath cells of all vascular bundles. Expressed in auricles, ligules, culm, guard cells brac hairs and pollen. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:17999151, ECO:0000269|PubMed:9076993}.
UniprotTISSUE SPECIFICITY: Expressed in root provascular and vascular cylinder, provascular and vascular strands of leaves, provascular and vascular strands of the whole panicle, in mature embryo provascular bundles of scutellum and embryonic axis and provascular and vascular strands of young immature spikelet organs. Expressed in differentiating and differentiated xylem and phloem elements, and in outer and inner bundle sheath cells of all vascular bundles. Expressed in auricles, ligules, culm, guard cells brac hairs and pollen. {ECO:0000269|PubMed:10934011, ECO:0000269|PubMed:17999151, ECO:0000269|PubMed:9076993}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription repressor involved leaf development. Binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. May act as a regulatory switch to specify provascular cell fate. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:10934011, ECO:0000269|PubMed:9076993}.
UniProtProbable transcription repressor involved leaf development. Binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. May act as a regulatory switch to specify provascular cell fate. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:9076993}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G148074_P01
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin and sucrose in primary root apical region. By wounding in leaves. {ECO:0000269|PubMed:10732669}.
UniProtINDUCTION: By auxin and sucrose in primary root apical region. By wounding in leaves. {ECO:0000269|PubMed:10934011}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9424520.0EU942452.1 Zea mays clone 1503625 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001318053.10.0homeobox-leucine zipper protein HOX1-like
SwissprotQ406919e-84HOX1_ORYSI; Homeobox-leucine zipper protein HOX1
SwissprotQ7XC549e-84HOX1_ORYSJ; Homeobox-leucine zipper protein HOX1
TrEMBLA0A1D6K8L40.0A0A1D6K8L4_MAIZE; Homeobox-leucine zipper protein HAT4
STRINGGRMZM2G148074_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25873889
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60390.11e-66homeobox-leucine zipper protein 3
Publications ? help Back to Top
  1. Scarpella E,Boot KJ,Rueb S,Meijer AH
    The procambium specification gene Oshox1 promotes polar auxin transport capacity and reduces its sensitivity toward inhibition.
    Plant Physiol., 2002. 130(3): p. 1349-60
    [PMID:12428000]
  2. Scarpella E,Rueb S,Meijer AH
    The RADICLELESS1 gene is required for vascular pattern formation in rice.
    Development, 2003. 130(4): p. 645-58
    [PMID:12505996]
  3. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]
  4. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  5. Scarpella E,Simons EJ,Meijer AH
    Multiple regulatory elements contribute to the vascular-specific expression of the rice HD-Zip gene Oshox1 in Arabidopsis.
    Plant Cell Physiol., 2005. 46(8): p. 1400-10
    [PMID:15964905]
  6. Meijer AH,Ouwerkerk PB,Hoge JH
    Vectors for transcription factor cloning and target site identification by means of genetic selection in yeast.
    Yeast, 1998. 14(15): p. 1407-15
    [PMID:9848232]