PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G146283_P01
Common Namepbf1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Dof
Protein Properties Length: 325aa    MW: 35055.3 Da    PI: 10.0321
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G146283_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof128.22.3e-4057116362
             zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                         +alkcprCds+ntkfCyynnys+sqPryfCkaCrryWt+GG+lrnvP+Ggg+rknk++s
  GRMZM2G146283_P01  57 PEALKCPRCDSNNTKFCYYNNYSMSQPRYFCKACRRYWTHGGTLRNVPIGGGCRKNKHAS 116
                        5789*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-3154113IPR003851Zinc finger, Dof-type
PfamPF027014.4E-3459114IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.31160114IPR003851Zinc finger, Dof-type
PROSITE patternPS0136106298IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MDMISGSTAA TSTPHNNQQA VMLSSPIIKE EARDPKQTRA MPQIGGSGER KPRPQLPEAL  60
KCPRCDSNNT KFCYYNNYSM SQPRYFCKAC RRYWTHGGTL RNVPIGGGCR KNKHASRFVL  120
GSHTSSSSSA TYAPLSPSTN ASSSNMSINK HMMMVPNMTM PTPTTMGLFP NVLPTLMPTG  180
GGGGFDFTMD NQHRSLSFTP MSLPSQGPVP MLAAGGSEAT PSFLEMLRGG IFHGSSSYNT  240
SLTMSGGNNG MDKPFSLPSY GAMCTNGLSG STTNDARQLV GPQQDNKAIM KSSNNNNGVS  300
LLNLYWNKHN NNNNNNNNNN NNKGQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.3470.0embryo| endosperm
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G146283
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Seed endosperm. {ECO:0000269|PubMed:9207153}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. May enhance the DNA binding of the bZIP transcription factor Opaque-2 to O2 binding site elements.
Function -- GeneRIF ? help Back to Top
  1. Prolamin-box binding factor (PBF) plays an essential role in the regulation of the temporal and spatial expression of gammaZ gene.
    [PMID: 18379885]
  2. The teosinte allele of pbf1 is expressed at about twice the level of the maize allele. pbf1 might regulate genes other than zeins and thereby is a domestication trait.
    [PMID: 24683184]
  3. o2 and Pbf RNA interference may affect the levels of some other transcription factor(s) or mRNA regulatory factor(s) that in turn would affect the transcript and protein levels of SSIIa and SBEI.
    [PMID: 27621432]
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G146283_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ7236980.0JQ723698.1 Zea mays prolamin box binding factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105400.20.0dof zinc finger protein PBF
SwissprotO244630.0PBF_MAIZE; Dof zinc finger protein PBF
TrEMBLA0A096SFL60.0A0A096SFL6_MAIZE; Prolamin box binding factor
STRINGGRMZM2G146283_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.16e-35TARGET OF MONOPTEROS 6
Publications ? help Back to Top
  1. Marz
    The maize Dof protein PBF activates transcription of gamma-zein during maize seed development.
    Plant Mol. Biol., 2008. 67(5): p. 441-54
    [PMID:18379885]
  2. Lang Z, et al.
    Defining the Role of prolamin-box binding factor1 Gene During Maize Domestication.
    J. Hered., 2014 Jul-Aug. 105(4): p. 576-582
    [PMID:24683184]
  3. Zhang Z,Zheng X,Yang J,Messing J,Wu Y
    Maize endosperm-specific transcription factors O2 and PBF network the regulation of protein and starch synthesis.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(39): p. 10842-7
    [PMID:27621432]
  4. Vicente-Carbajosa J,Moose SP,Parsons RL,Schmidt RJ
    A maize zinc-finger protein binds the prolamin box in zein gene promoters and interacts with the basic leucine zipper transcriptional activator Opaque2.
    Proc. Natl. Acad. Sci. U.S.A., 1997. 94(14): p. 7685-90
    [PMID:9207153]