PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G144744_P01
Common NameD8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family GRAS
Protein Properties Length: 630aa    MW: 66028.9 Da    PI: 4.7928
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G144744_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS459.81.6e-1402436231374
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl...fsevsP 89 
                        lv++Ll+cAeav+++++++a+al++++  las++g +m+++aayf eALa+r++r        ++p ++s  +  ++++a+ l   f+e +P
  GRMZM2G144744_P01 243 LVHALLACAEAVQQENFSAAEALVKQIPMLASSQGGAMRKVAAYFGEALARRVYR--------FRPPPDS--SLLDAAFADLLhahFYESCP 324
                        689****************************************************........3333333..34444444444445****** PP

               GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvl 181
                        +lkf+h+taNqaIlea++g++rvH++Df+i+qG+QWpaLlqaLa Rp+gpps+R+Tgvg+p+++++++l+++g++La+fA++++v+f+++ l
  GRMZM2G144744_P01 325 YLKFAHFTANQAILEAFAGCRRVHVVDFGIKQGMQWPALLQALALRPGGPPSFRLTGVGPPQPDETDALQQVGWKLAQFAHTIRVDFQYRGL 416
                        ******************************************************************************************** PP

               GRAS 182 vakrledleleeLrvkp......gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                        va +l+dle+ +L+ +        E++aVn+v++lhrll+++++le+    vL +v+ ++P++v+vveqea+hns++Fl+rf+e+l+yys++
  GRMZM2G144744_P01 417 VAATLADLEPFMLQPEGddtddePEVIAVNSVFELHRLLAQPGALEK----VLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTM 504
                        *************55444455579***********************....***************************************** PP

               GRAS 268 fdsleak..........lpres.eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sd 347
                        fdsle             p+++  +++++++++lgr+i+nvvacegaer+erhetl++Wr+rl+ +GF pv+l+++a+kqa++ll+ ++ +d
  GRMZM2G144744_P01 505 FDSLEGAgagsgqstdaSPAAAgGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRSRLGGSGFAPVHLGSNAYKQASTLLALFAgGD 596
                        ****777788888888644444799******************************************************************* PP

               GRAS 348 gyrveeesgslvlgWkdrpLvsvSaWr 374
                        gyrvee++g+l+lgW++rpL+++SaWr
  GRMZM2G144744_P01 597 GYRVEEKDGCLTLGWHTRPLIATSAWR 623
                        **************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011291.1E-3238120No hitNo description
PfamPF120411.0E-3538114IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098567.87217602IPR005202Transcription factor GRAS
PfamPF035145.5E-138243623IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0042176Biological Processregulation of protein catabolic process
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 630 aa     Download sequence    Send to blast
MKREYQDAGG SGGDMGSSKD KMMAAAAGAG EQEEEDVDEL LAALGYKVRS SDMADVAQKL  60
EQLEMAMGMG GVGGAGATAD DGFVSHLATD TVHYNPSDLS SWVESMLSEL NAPPAPLPPA  120
TPAPRLASTS STVTSGAAAG AGYFDLPPAV DSSSSTYALK PIPSPVAAPS ADPSTDSARE  180
PKRMRTGGGS TSSSSSSSSS MDGGRTRSSV VEAAPPATQA SAAANGPAVP VVVVDTQEAG  240
IRLVHALLAC AEAVQQENFS AAEALVKQIP MLASSQGGAM RKVAAYFGEA LARRVYRFRP  300
PPDSSLLDAA FADLLHAHFY ESCPYLKFAH FTANQAILEA FAGCRRVHVV DFGIKQGMQW  360
PALLQALALR PGGPPSFRLT GVGPPQPDET DALQQVGWKL AQFAHTIRVD FQYRGLVAAT  420
LADLEPFMLQ PEGDDTDDEP EVIAVNSVFE LHRLLAQPGA LEKVLGTVRA VRPRIVTVVE  480
QEANHNSGTF LDRFTESLHY YSTMFDSLEG AGAGSGQSTD ASPAAAGGTD QVMSEVYLGR  540
QICNVVACEG AERTERHETL GQWRSRLGGS GFAPVHLGSN AYKQASTLLA LFAGGDGYRV  600
EEKDGCLTLG WHTRPLIATS AWRVAAAAAP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-572436234375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.979820.0cell culture| ear| meristem| ovary| shoot| tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G144744
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00611ChIP-seqTransfer from AT2G01570Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G144744_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0542620.0BT054262.1 Zea mays full-length cDNA clone ZM_BFb0203D23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002466594.10.0hypothetical protein SORBIDRAFT_01g010660
SwissprotQ9ST480.0DWRF8_MAIZE; DELLA protein DWARF8
TrEMBLB7ZY700.0B7ZY70_MAIZE; Uncharacterized protein
STRINGGRMZM2G144744_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12511550
MonocotsOGMP99838138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.11e-180GRAS family protein
Publications ? help Back to Top
  1. Peng J, et al.
    'Green revolution' genes encode mutant gibberellin response modulators.
    Nature, 1999. 400(6741): p. 256-61
    [PMID:10421366]
  2. Thornsberry JM, et al.
    Dwarf8 polymorphisms associate with variation in flowering time.
    Nat. Genet., 2001. 28(3): p. 286-9
    [PMID:11431702]
  3. Remington DL, et al.
    Structure of linkage disequilibrium and phenotypic associations in the maize genome.
    Proc. Natl. Acad. Sci. U.S.A., 2001. 98(20): p. 11479-84
    [PMID:11562485]
  4. Andersen JR,Schrag T,Melchinger AE,Zein I,Lübberstedt T
    Validation of Dwarf8 polymorphisms associated with flowering time in elite European inbred lines of maize (Zea mays L.).
    Theor. Appl. Genet., 2005. 111(2): p. 206-17
    [PMID:15933874]
  5. Camus-Kulandaivelu L, et al.
    Patterns of molecular evolution associated with two selective sweeps in the Tb1-Dwarf8 region in maize.
    Genetics, 2008. 180(2): p. 1107-21
    [PMID:18780751]