PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G144480_P01
Common NameZEAMMB73_391442
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 172aa    MW: 19293.5 Da    PI: 10.1567
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G144480_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.91.6e-1192147560
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                        +r rr+ +NRe+ArrsR RK+ ++ eL   v  L + N++L + l++    +a  +
  GRMZM2G144480_P01  92 RRRRRMVSNRESARRSRVRKQRQLSELWAQVSHLRGANRRLLDDLNRALRSCADAR 147
                        799****************************************9999877777655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.7E-987152IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.09490153IPR004827Basic-leucine zipper domain
PfamPF001705.3E-991145IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1709.7E-992165No hitNo description
SuperFamilySSF579595.06E-1092140No hitNo description
PROSITE patternPS00036095110IPR004827Basic-leucine zipper domain
CDDcd147024.79E-1397144No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MYHHHFHGEV DSLRFLSPPT TASFAAAHHQ HMNMPLPPPA YYLAIDGDAA CFDELDTIVR  60
EAAAHLGGNS NNESPSLSGS GSDSAAAADQ ERRRRRMVSN RESARRSRVR KQRQLSELWA  120
QVSHLRGANR RLLDDLNRAL RSCADARREN ARLRDEKAQL ANRLHQLLII AG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1104110RRSRVRK
2104111RRSRVRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.498001e-87shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G144480
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G144480_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9766323e-85EU976632.1 Zea mays clone 985663 bZIP protein mRNA, complete cds.
GenBankKJ7275103e-85KJ727510.1 Zea mays clone pUT5369 bZIP transcription factor (bZIP126) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008679514.11e-122basic leucine zipper 43
TrEMBLA0A1D6QK716e-95A0A1D6QK71_MAIZE; Putative bZIP transcription factor superfamily protein
STRINGGRMZM2G144480_P011e-122(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118635126
Representative plantOGRP1302545