PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G144172_P01
Common NameLOC103625762, Zm.34380
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Dof
Protein Properties Length: 426aa    MW: 42888.3 Da    PI: 9.4559
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G144172_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.81.2e-38114174262
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                        +e  lkcprC+stntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGgg+r+nk+++
  GRMZM2G144172_P01 114 PEPGLKCPRCESTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKRTK 174
                        56789*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-3998172IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.609118172IPR003851Zinc finger, Dof-type
PfamPF027013.0E-32118172IPR003851Zinc finger, Dof-type
PROSITE patternPS013610120156IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MVFSSVPVYL DPPNWSQHHH QPQQQQQQQH AQHGQLPSGG NGGGGGGMDT HAHHHHHQLP  60
PVPPPPSGAL MAPRPDMSAM VPAASGGGGP TSGGTAIRPG SMTERAKLAK IPQPEPGLKC  120
PRCESTNTKF CYFNNYSLSQ PRHFCKTCRR YWTRGGALRN VPVGGGCRRN KRTKSSKSNS  180
SSAAASASGG AGGTSSSTSS TATGGSSSAG AIMPSHQGQL QPFLASLHHP LAGGGGGGDH  240
YSTGASRLGF PGLSSLDPMD YHQFGAGAGA GASSAAIGLE QWRLPHIQQF PFLSGRPDPV  300
QPTMSSIYPF DLEGHGGDAP GFPGGHMLGA SKVPGSAGLI TQLASVKMED NPASAAMASS  360
SPREFLSLPG NLQFWGGGGN NNGGASGNNG GGAGNGGGGG GGGAVAPGSS WVDLSGFNSS  420
SSGNVL
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G144172
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G144172_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0849760.0BT084976.2 Zea mays full-length cDNA clone ZM_BFb0218L20 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001333785.10.0dof zinc finger protein DOF2.4-like
TrEMBLA0A1D6GE511e-171A0A1D6GE51_MAIZE; Dof zinc finger protein DOF3.6
STRINGGRMZM2G144172_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP48932961
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.15e-43Dof family protein