PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G142962_P02
Common NameLOC103643128
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family HD-ZIP
Protein Properties Length: 448aa    MW: 46748.1 Da    PI: 8.9009
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G142962_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox573.3e-18264318256
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        rk+ +++keq   Lee F+++++++ ++++ LAk+l+L  rqV vWFqNrRa+ k
  GRMZM2G142962_P02 264 RKKLRLSKEQSAFLEESFKEHSTLNPKQKAALAKQLNLRPRQVEVWFQNRRARTK 318
                        788899***********************************************98 PP

2HD-ZIP_I/II127.46.2e-41264354192
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                        +kk+rlskeq+++LEesF+e+++L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  GRMZM2G142962_P02 264 RKKLRLSKEQSAFLEESFKEHSTLNPKQKAALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLHKELAELR-ALK 354
                        69*************************************************************************************9.565 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.5E-18246318IPR009057Homeodomain-like
SuperFamilySSF466894.11E-18253321IPR009057Homeodomain-like
PROSITE profilePS5007117.248260320IPR001356Homeobox domain
SMARTSM003894.9E-16262324IPR001356Homeobox domain
PfamPF000461.2E-15264318IPR001356Homeobox domain
CDDcd000861.13E-17264321No hitNo description
PROSITE patternPS000270295318IPR017970Homeobox, conserved site
PfamPF021831.4E-10320354IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.7E-25320363IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 448 aa     Download sequence    Send to blast
MLPCLLPFAG PLTCARQTAV PKGQNQARVL AACSVTRLAE LSHSHAVATL SPQLLLHNAR  60
SSICRRYKPS LPSLYYGRLL LLLLVGVELF LGAGMELGLS LGDAAVPDAG RAAPELGLGL  120
GVGIGSNAAG TGRGSKAAGT TGTTGWWAAP ATPESAVRLS LVSSLGLQWP PPDGGICHVG  180
RDEAPARGFD VNRAPSVAGS ALALEDDEEE PGAAALSSSP NDSAGSFPLD LGGPRAHAEG  240
AAARAGGERS SSRASDEDEG ASARKKLRLS KEQSAFLEES FKEHSTLNPK QKAALAKQLN  300
LRPRQVEVWF QNRRARTKLK QTEVDCEYLK RCCETLTEEN RRLHKELAEL RALKTAPPFF  360
MRLPATTLSM CPSCERVASG PSPASTSAPA SSTPPATAAT TAISYAAAAA APVRADHRPS  420
SFAALFAATR SFPLASQPRP PAPASNCL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1312320RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.91741e-138ear| leaf| meristem| ovary| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G142962
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G142962_P02
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2411960.0AK241196.1 Oryza sativa Japonica Group cDNA, clone: J065121H01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008664503.10.0homeobox-leucine zipper protein HOX27
SwissprotQ6YPD01e-131HOX27_ORYSJ; Homeobox-leucine zipper protein HOX27
TrEMBLA0A317Y6620.0A0A317Y662_MAIZE; Homeobox-leucine zipper protein HOX27
STRINGGRMZM2G142962_P020.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52093363
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-68homeobox from Arabidopsis thaliana