PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G141955_P04
Common Namepco127567(465), YAB11
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family YABBY
Protein Properties Length: 141aa    MW: 15787 Da    PI: 8.4033
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G141955_P04genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY137.61.4e-4271415134
              YABBY   5 ssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsv 96 
                          +++vCyv+CnfCnt+lavsvP +s++++vtvrCGhCt+llsvnl+  ++ ++ +++l+++   +++ +l+ +++    ++ +  s+s+s+
  GRMZM2G141955_P04   7 APADHVCYVHCNFCNTVLAVSVPGNSMLSMVTVRCGHCTNLLSVNLRALMHSVPEQDQLQQENI-RVHGTLREHHQCGGGHHLELGSSSSSR 97 
                        5789******************************************************987654.466677766666555554444433333 PP

              YABBY  97 .ssekl....senedeevprvppvirP.PekrqrvPsaynrfik 134
                         +  ++    ++ne+    ++ +  rP PekrqrvPsaynrfik
  GRMZM2G141955_P04  98 fRLPMMmsyaPQNEHLLQEQTLNNARPaPEKRQRVPSAYNRFIK 141
                        0222223443222222223333456766***************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046904.6E-428141IPR006780YABBY protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 141 aa     Download sequence    Send to blast
MSSAQIAPAD HVCYVHCNFC NTVLAVSVPG NSMLSMVTVR CGHCTNLLSV NLRALMHSVP  60
EQDQLQQENI RVHGTLREHH QCGGGHHLEL GSSSSSRFRL PMMMSYAPQN EHLLQEQTLN  120
NARPAPEKRQ RVPSAYNRFI K
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.1180590.0ovary
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G141955
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G141955_P04
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0605290.0BT060529.1 Zea mays full-length cDNA clone ZM_BFb0012C02 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001140845.11e-102uncharacterized protein LOC100272921
SwissprotQ2QM172e-46YAB6_ORYSJ; Protein YABBY 6
TrEMBLB4FRP91e-102B4FRP9_MAIZE; C2C2-YABBY transcription factor
STRINGGRMZM2G141955_P031e-101(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45190.19e-28YABBY family protein