PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G140355_P01
Common NameZEAMMB73_553239
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 138aa    MW: 15186.9 Da    PI: 10.9415
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G140355_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.73.4e-1555116162
                        XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                        +ke +r +r+ +NR++A+  R+RKka++ eLe +vkeLe+ N++L ++l++l++e + l++ 
  GRMZM2G140355_P01  55 DKEHRRLKRLLRNRVSAQQARERKKAYLSELEVRVKELEKRNSELEEKLSTLQNENQMLRQI 116
                        58899****************************************************99886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR000419.7E-55470IPR001630cAMP response element binding (CREB) protein
SMARTSM003385.8E-1555119IPR004827Basic-leucine zipper domain
PfamPF001703.3E-1456117IPR004827Basic-leucine zipper domain
PROSITE profilePS5021712.81757120IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.6E-1759119No hitNo description
SuperFamilySSF579591.94E-1359117No hitNo description
PROSITE patternPS0003606277IPR004827Basic-leucine zipper domain
CDDcd147041.93E-1169111No hitNo description
PRINTSPR000419.7E-57292IPR001630cAMP response element binding (CREB) protein
PRINTSPR000419.7E-592109IPR001630cAMP response element binding (CREB) protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 138 aa     Download sequence    Send to blast
MESDEEIRRV PEVGLELLTS PSTSGREATA AAAAAGTSSA SQAASASRRG RSPADKEHRR  60
LKRLLRNRVS AQQARERKKA YLSELEVRVK ELEKRNSELE EKLSTLQNEN QMLRQILKNT  120
TVNNRRGPGS SSAGGDSQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2oqq_A2e-1580119342Transcription factor HY5
2oqq_B2e-1580119342Transcription factor HY5
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G140355
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that promotes photomorphogenesis in the light and positively regulates fruit pigmentation and fruit nutritional quality. Probably acts downstream of the light receptor network and directly affects transcription of light-induced genes. {ECO:0000269|PubMed:15178762}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G140355_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3756943e-66AK375694.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3101I12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008659719.16e-91transcription factor HY5
SwissprotQ9SM506e-51HY5_SOLLC; Transcription factor HY5
TrEMBLA0A3L6DGG91e-90A0A3L6DGG9_MAIZE; Transcription factor HY5
TrEMBLK7VAC71e-90K7VAC7_MAIZE; Putative bZIP transcription factor superfamily protein
STRINGGRMZM2G140355_P012e-91(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP140838111
Representative plantOGRP20811737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11260.16e-38bZIP family protein
Publications ? help Back to Top
  1. Wang F, et al.
    Light Signaling-Dependent Regulation of Photoinhibition and Photoprotection in Tomato.
    Plant Physiol., 2018. 176(2): p. 1311-1326
    [PMID:29146776]
  2. Liu CC, et al.
    The bZip transcription factor HY5 mediates CRY1a-induced anthocyanin biosynthesis in tomato.
    Plant Cell Environ., 2018. 41(8): p. 1762-1775
    [PMID:29566255]