PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G138455_P01
Common NameZm.18635
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Dof
Protein Properties Length: 450aa    MW: 47264.1 Da    PI: 6.6915
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G138455_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1252.3e-39108167261
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                        ++k l+cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGa+rnvPvG+grrknk++
  GRMZM2G138455_P01 108 PDKVLPCPRCNSMDTKFCYFNNYNVNQPRHFCKNCQRYWTAGGAMRNVPVGAGRRKNKNA 167
                        78999****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-31104165IPR003851Zinc finger, Dof-type
PfamPF027017.2E-32109166IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.984112166IPR003851Zinc finger, Dof-type
PROSITE patternPS013610114150IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 450 aa     Download sequence    Send to blast
MVAECHGGGG AAAGGGDFLI KLFGMTIPVP ECGDAKDLQQ SKSNRWTEQD QDSHGLETAP  60
APAHTDTSDP SPQPEVVDAE DPTETQQRPC NGDGDGDAAG QREKLKKPDK VLPCPRCNSM  120
DTKFCYFNNY NVNQPRHFCK NCQRYWTAGG AMRNVPVGAG RRKNKNAAAS HFFQRVRATN  180
ATVLSFGGHG GAPPAARLDL DLAEQLSHQL APVRSAGDAG RPCSEGSSSR DGNGSRSSVD  240
EAAANADDGS VQQHPGPASM NSSGATVWPP YSCAPAPAAY FPQGIAIPIY PAAPAYWGCM  300
VPGAWSLPWP VQHPSSSSSP TTTSAPSVVS SSGAADDSSS HALGKRPRDR EGDDGRNGGN  360
AKVWAPKSIR IDDVDEVARS SIWSLVGIKG DQTKQQDAAD DHAGGHSKQL GTVFEPKRGE  420
ATKKAMMTSS PLLHANPVAL TRSVAFQEGS
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G138455
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G138455_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX4284590.0JX428459.1 Zea mays subsp. mays clone pUT3054 DOF40 C2C2-DOF type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001143091.10.0uncharacterized protein LOC100275567
TrEMBLA0A1D6KVQ30.0A0A1D6KVQ3_MAIZE; DOF40 C2C2-DOF type transcription factor
TrEMBLA0A317Y9P80.0A0A317Y9P8_MAIZE; Cyclic dof factor 2
TrEMBLK0DCM60.0K0DCM6_MAIZE; DOF40 C2C2-DOF type transcription factor (Fragment)
STRINGGRMZM2G138455_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20993793
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.24e-42cycling DOF factor 2