PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G137502_P01
Common Namecl830_1(337), DOF36
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Dof
Protein Properties Length: 351aa    MW: 36732.1 Da    PI: 4.7224
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G137502_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.38.2e-3961121262
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                        +++a +cprC stntkfCyynny+l+qPryfCk+CrryWt+GG+lrnvPvGgg+r+nk++s
  GRMZM2G137502_P01  61 PDAAHSCPRCSSTNTKFCYYNNYNLTQPRYFCKTCRRYWTHGGTLRNVPVGGGCRRNKRAS 121
                        577899****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2462119IPR003851Zinc finger, Dof-type
PfamPF027011.5E-3264119IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.17165119IPR003851Zinc finger, Dof-type
PROSITE patternPS01361067103IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0008018anatomytransition vascular leaf
PO:0009025anatomyvascular leaf
PO:0020040anatomyleaf base
PO:0020127anatomyprimary root
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0007015developmental stageradicle emergence stage
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MDMNSNANNS TAAAASAPIN NQQEAVVSSP TRKEQARNPK KARAAPQQAG GSGEPRPRPP  60
PDAAHSCPRC SSTNTKFCYY NNYNLTQPRY FCKTCRRYWT HGGTLRNVPV GGGCRRNKRA  120
SSSSSPFPGP SSTAATSAAM EKTVSTRLML MATSTMAMPS PTAGLFVPDD MSPAFTPTTG  180
GSGFDDLAGM DEQHQQGFLP FSPLSLSDQA PELAPGGGGD TTPSFLDMLT GGYLDGGGYG  240
GMSGGSDAMD MPFSLPEMGP PTTDPMPFQL QWTSSELDNY INDDGGYAAG PAAGVQQQQQ  300
QQQQQINGGD HQKQDENKEA GNGKGNDDGG GGSSSVYSFW MNTSGSDGAE G
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.330780.0endosperm
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G137502
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Seed endosperm. {ECO:0000269|PubMed:9207153}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. May enhance the DNA binding of the bZIP transcription factor Opaque-2 to O2 binding site elements.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G137502_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0353050.0BT035305.1 Zea mays full-length cDNA clone ZM_BFb0054C13 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001131758.10.0uncharacterized protein LOC100193126
SwissprotO244639e-72PBF_MAIZE; Dof zinc finger protein PBF
TrEMBLA0A317YCU10.0A0A317YCU1_MAIZE; Dof zinc finger protein PBF
TrEMBLB4FDW70.0B4FDW7_MAIZE; C2C2-DOF transcription factor
STRINGGRMZM2G137502_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.14e-32TARGET OF MONOPTEROS 6
Publications ? help Back to Top
  1. Lang Z, et al.
    Defining the Role of prolamin-box binding factor1 Gene During Maize Domestication.
    J. Hered., 2014 Jul-Aug. 105(4): p. 576-582
    [PMID:24683184]
  2. Zhang Z,Zheng X,Yang J,Messing J,Wu Y
    Maize endosperm-specific transcription factors O2 and PBF network the regulation of protein and starch synthesis.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(39): p. 10842-7
    [PMID:27621432]