PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G136266_P02
Common NameZEAMMB73_620403, Zm.119007
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 334aa    MW: 36006.8 Da    PI: 6.5926
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G136266_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.32.2e-10168226563
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                        kr++r   NR +A rs +RK +++ eLe+kv++L++e ++L  +l  l+     l++e+
  GRMZM2G136266_P02 168 KRAKRILANRQSAARSKERKIMYTSELEKKVQTLQTEATTLSAQLTLLQRDTTGLTAEN 226
                        9********************************************99998877777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.3E-16164228IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.852166229IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.1E-11168222No hitNo description
PfamPF001703.9E-9168222IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.88E-11168222No hitNo description
CDDcd147031.80E-23169218No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MDPRFPLPAA AAPSTGGGGG ARGHHRRAHS ETFLSFHDAD LLLDPDGDFF SDLDFPSLSD  60
DSPAASDPTP PPHPQQQPPQ ASPAPRPPGG THTRSLSLDA AFFEGLAFQG PSGSAGGGGG  120
PGHKRSGSMD GDTSPFEGES ALSSGLPDYA KKAMPAERIA ELALIDPKRA KRILANRQSA  180
ARSKERKIMY TSELEKKVQT LQTEATTLSA QLTLLQRDTT GLTAENRELK LRLQSMEEQA  240
KLRDALNEAL REEVQRLKIA AGQVGNMNGN PFNGGLQQQI PSYFVQQQQQ QQTPYFGGHQ  300
AQLHNQNQNH RHQISSNVGQ TLSGQSLNDS MDFM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1180188ARSKERKIM
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.1190070.0ear| meristem| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G136266
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mostly expressed in dividing cells, present in leaves, roots and seedlings. {ECO:0000269|PubMed:15108305, ECO:0000269|PubMed:15824315}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds specifically to the VIP1 response elements (VREs) DNA sequence 5'-ACNGCT-3' found in some stress genes (e.g. TRX8 and MYB44), when phosphorylated/activated by MPK3. Required for Agrobacterium VirE2 nuclear import and tumorigenicity. Promotes transient expression of T-DNA in early stages by interacting with VirE2 in complex with the T-DNA and facilitating its translocation to the nucleus, and mediates stable genetic transformation by Agrobacterium by binding H2A histone. Prevents cell differentiation and shoot formation. Limits sulfate utilization efficiency (SUE) and sulfate uptake, especially in low-sulfur conditions. {ECO:0000269|PubMed:11432846, ECO:0000269|PubMed:12124400, ECO:0000269|PubMed:15108305, ECO:0000269|PubMed:15824315, ECO:0000269|PubMed:17947581, ECO:0000269|PubMed:19820165, ECO:0000269|PubMed:20547563}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G136266_P02
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Transcriptionally activated during the acquisition of pluripotentiality (in protoplasts) by pericentromeric chromatin decondensation and DNA demethylation. Targeted to degradation by the proteasome by VBF and Agrobacterium virF in SCF(VBF) and SCF(virF) E3 ubiquitin ligase complexes after mediating T-DNA translocation to the nucleus. {ECO:0000269|PubMed:15108305}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0394040.0BT039404.1 Zea mays full-length cDNA clone ZM_BFc0012D19 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001151647.10.0transcription factor PosF21
SwissprotQ9MA751e-70VIP1_ARATH; Transcription factor VIP1
TrEMBLB4FQL60.0B4FQL6_MAIZE; Transcription factor VIP1
TrEMBLK7TX820.0K7TX82_MAIZE; Transcription factor VIP1
STRINGGRMZM2G136266_P010.0(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G43700.11e-44VIRE2-interacting protein 1
Publications ? help Back to Top
  1. Wang Y, et al.
    The putative Agrobacterium transcriptional activator-like virulence protein VirD5 may target T-complex to prevent the degradation of coat proteins in the plant cell nucleus.
    New Phytol., 2014. 203(4): p. 1266-81
    [PMID:24865527]
  2. Xu DB, et al.
    A G-protein β subunit, AGB1, negatively regulates the ABA response and drought tolerance by down-regulating AtMPK6-related pathway in Arabidopsis.
    PLoS ONE, 2015. 10(1): p. e0116385
    [PMID:25635681]
  3. Chen J, et al.
    ZmbZIP91 regulates expression of starch synthesis-related genes by binding to ACTCAT elements in their promoters.
    J. Exp. Bot., 2016. 67(5): p. 1327-38
    [PMID:26689855]
  4. Tsugama D,Liu S,Takano T
    VIP1 is very important/interesting protein 1 regulating touch responses of Arabidopsis.
    Plant Signal Behav, 2016. 11(6): p. e1187358
    [PMID:27171129]
  5. Tsugama D,Liu S,Takano T
    The bZIP Protein VIP1 Is Involved in Touch Responses in Arabidopsis Roots.
    Plant Physiol., 2016. 171(2): p. 1355-65
    [PMID:27208231]
  6. Takeo K,Ito T
    Subcellular localization of VIP1 is regulated by phosphorylation and 14-3-3 proteins.
    FEBS Lett., 2017. 591(13): p. 1972-1981
    [PMID:28542772]
  7. Wang L,Lacroix B,Guo J,Citovsky V
    The Agrobacterium VirE2 effector interacts with multiple members of the Arabidopsis VIP1 protein family.
    Mol. Plant Pathol., 2018. 19(5): p. 1172-1183
    [PMID:28802023]