PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G135703_P01
Common NameDOF19, LOC103650966, Zm.2286
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Dof
Protein Properties Length: 334aa    MW: 34942.8 Da    PI: 4.5319
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G135703_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.46.6e-383591561
             zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                       a +cprCds ntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rkn++ 
  GRMZM2G135703_P01 35 APSCPRCDSPNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKNRRG 91
                       568***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-341890IPR003851Zinc finger, Dof-type
PfamPF027017.4E-323690IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.8913690IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103874IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MLSSHHEAAM LPYAPGPPPS LLLDRRSYKQ GGEAAPSCPR CDSPNTKFCY YNNYSLSQPR  60
YFCKGCRRYW TKGGSLRNVP VGGGCRKNRR GKSSLRSAAD SIASGGGGRD AAFGHRFPGP  120
VRPDLVLEGM VGNHPSNPAG QAAMPGGVPA AADGSTIDLA MLYAKFLNHP PAEEGVGAVT  180
PPESAGQVDE AFGASSDLMS PGALAPVQFD PCQDGFGEWS GVPVSSAGPS STASTTAATT  240
MLCTDVSVQA AFGELNFAMD QNCFDSLGLP TDDVGNLSSS WCSIVPGLST LEDAKYDLDS  300
FPDDALSLHD EGMISGTDHD WSVDCQGLET LYMP
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G135703
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G135703_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7269750.0KJ726975.1 Zea mays clone pUT3676 C2C2-DOF transcription factor (DOF19) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008674783.10.0dof zinc finger protein 4
TrEMBLA0A060CVI00.0A0A060CVI0_MAIZE; C2C2-DOF transcription factor (Fragment)
STRINGGRMZM2G135703_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26593683
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21340.11e-36Dof family protein