PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G134863_P02
Common NameLOC100384730
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 98aa    MW: 10960.9 Da    PI: 11.9899
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G134863_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_126.71.2e-0847892163
                       HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1 21 RqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                       R+RKk+++ e ++ v +L+ eN+aL+ke+  l+  + +l +e+
  GRMZM2G134863_P02 47 RARKKMRLPEIQQMVRSLSVENDALRKEMRALQRDCTALSQEN 89
                       9**************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1708.6E-74787No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 98 aa     Download sequence    Send to blast
MTSFCARSVT RRMTSFTAPE GVGGLAGRRT IPAVPVPLPP PRPAGQRARK KMRLPEIQQM  60
VRSLSVENDA LRKEMRALQR DCTALSQENG KLELKIRF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14652RARKKMR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.790141e-119ovary| pericarp
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G134863
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G134863_P02
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0840711e-117BT084071.1 Zea mays full-length cDNA clone ZM_BFb0070K03 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002438747.19e-34formin-like protein 4
TrEMBLC5Z6R72e-32C5Z6R7_SORBI; Uncharacterized protein
STRINGSb10g025450.14e-33(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36730.22e-06G-box binding factor 1