PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G134863_P01
Common NameLOC100384730
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 274aa    MW: 28425.9 Da    PI: 9.7745
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G134863_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_125.52.8e-081832252163
                        HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1  21 RqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                        R+RKk+++ e ++ v +L+ eN+aL+ke+  l+  + +l +e+
  GRMZM2G134863_P01 183 RARKKMRLPEIQQMVRSLSVENDALRKEMRALQRDCTALSQEN 225
                        9**************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1706.0E-6183223No hitNo description
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006340anatomyadult vascular leaf
PO:0009025anatomyvascular leaf
PO:0025142anatomyleaf tip
PO:0001052developmental stagevascular leaf expansion stage
PO:0007101developmental stageLP.09 nine leaves visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MTAADGEACA VVATAADIIC SLRGADLAGW TPPWSQRQHE PDPARDGVQA EGGDDARDLA  60
WPAVARGKRS RSRRESPSAS GSAASAGATT TATKKKTARR GARGSPASPL DYSGASGSGS  120
GASTSGGEDG AFCSRPDPAL PPAAACQQLA APPPPSKVGG LAGRRTIPAV PVPLPPPRPA  180
GQRARKKMRL PEIQQMVRSL SVENDALRKE MRALQRDCTA LSQENGKLET RLHQSITLSE  240
AISVENKGKP RPLQPEQEAP SGFVLPDLNL PADV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16772KRSRSR
2182188RARKKMR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.790140.0ovary| pericarp
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G134863
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G134863_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0840710.0BT084071.1 Zea mays full-length cDNA clone ZM_BFb0070K03 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001170669.10.0uncharacterized protein LOC100384730
TrEMBLC4IZS40.0C4IZS4_MAIZE; Uncharacterized protein
STRINGGRMZM2G134863_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37902951
Representative plantOGRP1737923
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36730.17e-06G-box binding factor 1