PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G134687_P01
Common NameLOC103635646, ZEAMMB73_454562
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family NAC
Protein Properties Length: 425aa    MW: 45293.9 Da    PI: 6.8603
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G134687_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM157.84.4e-49521772128
                NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                        +pGfrFhPt+eel+ +yL++kvegk++++ e i+ +d+y+++Pw+Lp+++  + kew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ + 
  GRMZM2G134687_P01  52 MPGFRFHPTEEELIEFYLRRKVEGKRFNV-ELIAFLDLYRFDPWELPAMAVMGGKEWFFYVPRDRKYRNGDRPNRVTASGYWKATGADRMIR 142
                        79***************************.89***************7767789************************************** PP

                NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++++ +glkktLvfy+g+apkg++++W+m+eyrl
  GRMZM2G134687_P01 143 GENSRPIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 177
                        *********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.22E-5650201IPR003441NAC domain
PROSITE profilePS5100554.70551201IPR003441NAC domain
PfamPF023651.7E-2453177IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MSGDLDDGHG AAAVGNVVAA AAGGEAAAEV AVGAGAAARE AAVDAHDNDV VMPGFRFHPT  60
EEELIEFYLR RKVEGKRFNV ELIAFLDLYR FDPWELPAMA VMGGKEWFFY VPRDRKYRNG  120
DRPNRVTASG YWKATGADRM IRGENSRPIG LKKTLVFYSG KAPKGVRSSW IMNEYRLPPP  180
PTDADPFIPK SEISLCRVYK RSGIDDTHGQ SSSSTQFASS ARRTSSRTGA PTVIRHGSSP  240
SPSSTPLSPT QQLSSFHLLQ GECSSASPPA PMMDQVVTVH SAPQQLLTHP SPCTYAPATT  300
ISISTAEAVP EWAQGAEAAF ASSYSLFNMA AAAGPMAAGS SRSSVDELST LVGHSQAYAN  360
LSAATGGHLL PLLTPPPPPM LQTMPLGALP IVAPPSSSVA DKLSWDWNQI PDTTGRDYNN  420
TSGFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-545320219166NAC domain-containing protein 19
4dul_A1e-545320219166NAC domain-containing protein 19
1ut7_B1e-545320219166NO APICAL MERISTEM PROTEIN
1ut7_A1e-545320219166NO APICAL MERISTEM PROTEIN
1ut4_B1e-545320219166NO APICAL MERISTEM PROTEIN
1ut4_A1e-545320219166NO APICAL MERISTEM PROTEIN
3swp_D2e-545320222169NAC domain-containing protein 19
3swp_C2e-545320222169NAC domain-containing protein 19
3swp_B2e-545320222169NAC domain-containing protein 19
3swp_A2e-545320222169NAC domain-containing protein 19
3swm_D2e-545320222169NAC domain-containing protein 19
3swm_C2e-545320222169NAC domain-containing protein 19
3swm_B2e-545320222169NAC domain-containing protein 19
3swm_A2e-545320222169NAC domain-containing protein 19
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G134687
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G134687_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0604780.0BT060478.1 Zea mays full-length cDNA clone ZM_BFb0004F04 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008656275.10.0PREDICTED: putative NAC domain-containing protein 94
TrEMBLK7VFK40.0K7VFK4_MAIZE; Putative NAC domain transcription factor superfamily protein
STRINGGRMZM2G134687_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP28263787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.27e-92NAC domain containing protein 35