PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G134260_P01
Common NameLOC103638100, ZEAMMB73_102722, Zm.131754
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family HD-ZIP
Protein Properties Length: 293aa    MW: 31098.9 Da    PI: 9.666
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G134260_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.27.8e-20112166256
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        rk+ +++k+q  +Lee+F+ +++++ +++ +LA++lgL  rqV vWFqNrRa+ k
  GRMZM2G134260_P01 112 RKKLRLSKDQAAVLEECFKTHSTLNPKQKVQLANRLGLRPRQVEVWFQNRRARTK 166
                        678899***********************************************98 PP

2HD-ZIP_I/II126.41.3e-40112202192
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                        +kk+rlsk+q+++LEe+F+++++L+p++Kv+la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++d+l++en+rLeke ++Lr +lk
  GRMZM2G134260_P01 112 RKKLRLSKDQAAVLEECFKTHSTLNPKQKVQLANRLGLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRWCDRLADENKRLEKELADLR-ALK 202
                        69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-1898162IPR009057Homeodomain-like
PROSITE profilePS5007116.876108168IPR001356Homeobox domain
SuperFamilySSF466891.8E-18110177IPR009057Homeodomain-like
SMARTSM003896.1E-17110172IPR001356Homeobox domain
CDDcd000862.13E-15112169No hitNo description
PfamPF000463.2E-17112166IPR001356Homeobox domain
PRINTSPR000311.3E-5139148IPR000047Helix-turn-helix motif
PROSITE patternPS000270143166IPR017970Homeobox, conserved site
PRINTSPR000311.3E-5148164IPR000047Helix-turn-helix motif
PfamPF021833.9E-10168202IPR003106Leucine zipper, homeobox-associated
SMARTSM003404.2E-20168211IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009074anatomystyle
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MMPQASASLD LGLSLGLTLT SQGSLSSSTT TAGSSPWAAA LSSVVADVAR ARGDAYAQHH  60
AGAAMTMRAS TSPDSGDTTT AKREREGELE RTGSGGVRSD EEDGADGGAG GRKKLRLSKD  120
QAAVLEECFK THSTLNPKQK VQLANRLGLR PRQVEVWFQN RRARTKLKQT EVDCEYLKRW  180
CDRLADENKR LEKELADLRA LKAAPPSSAA AQPASAAATL TMCPSCRRVA AAASHHHQPP  240
PPQCHPKPTV AAGGGSVVPR PSHCQFFPAA AVDRTSQGTW NTAAPPLVTR ELF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1160168RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.215732e-84cell culture| meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G134260
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, leaves, nodes, internodes, flowers and embryo. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:17999151}.
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, leaves, nodes, internodes, flowers and embryo. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
UniProtProbable transcription factor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G134260_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0932881e-127FP093288.1 Phyllostachys edulis cDNA clone: bphylf053m07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008659311.10.0homeobox-leucine zipper protein HOX2
SwissprotQ5VPE34e-91HOX2_ORYSJ; Homeobox-leucine zipper protein HOX2
SwissprotQ84U864e-91HOX2_ORYSI; Homeobox-leucine zipper protein HOX2
TrEMBLK7VEZ80.0K7VEZ8_MAIZE; Putative homeobox DNA-binding and leucine zipper domain family protein
STRINGGRMZM2G134260_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38423376
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.15e-45homeobox from Arabidopsis thaliana
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]