PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G133972_P02
Common NameZEAMMB73_130915, Zm.25445
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family WOX
Protein Properties Length: 514aa    MW: 53241.8 Da    PI: 7.6919
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G133972_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox51.22.2e-1672132257
                        T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
           Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                        ++R+++ +eq+++Le+ F++   +p ++e+ ++ ++l    ++ +++V++WFqNr+ + k+
  GRMZM2G133972_P02  72 KPRWNPRPEQIRILEAIFNSgMVNPPRDEIPRIRMRLqeygQVGDANVFYWFQNRKSRSKN 132
                        89*****************99*************************************995 PP

2Wus_type_Homeobox110.21.2e-3571134265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        +++RW+P+peQi+iLe++++sG+++P+++ei ri+++L+eyG+++d+NVfyWFQNrk+R+++kq
  GRMZM2G133972_P02  71 PKPRWNPRPEQIRILEAIFNSGMVNPPRDEIPRIRMRLQEYGQVGDANVFYWFQNRKSRSKNKQ 134
                        579***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.32E-1265137IPR009057Homeodomain-like
PROSITE profilePS500719.97768133IPR001356Homeobox domain
SMARTSM003891.2E-670137IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.3E-671138IPR009057Homeodomain-like
CDDcd000862.08E-671134No hitNo description
PfamPF000464.7E-1472131IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 514 aa     Download sequence    Send to blast
MASSFNNKTS HWPSMFRSKH AAEPWQAQPD ISSSPPSLLS GGGSSSTTTI GRCLKHPLSG  60
YSGGEERTPD PKPRWNPRPE QIRILEAIFN SGMVNPPRDE IPRIRMRLQE YGQVGDANVF  120
YWFQNRKSRS KNKQRTGQLG LGLARAPGCG AAAPPVTPQP LIQNQFQVLA SPAQAPASSS  180
SSSSDRSSGS SKPAPQPMSA TAAAMNFPGP LGAACAQMYY QAHPVAPVSA LPAHKVQDPV  240
ASDEPVFQPW PQGYFLSAAE VASILGGQYR HDVPVQQQPP ATLPAGAFLG LYNEVTEPTV  300
TGHRTCAWGP AGLGQFWPVG GADHHQHHKH NTTAATNTVA RDAAHEHATT LGLLQYGFEA  360
SAAMETASAA VPLAASPGTA ASVATAGLTS LPASTNAVVV NYDLLQGLAV PGSGSGAVGV  420
STGGAPPVAV AAAPTAAQEG VVVALCITDS VTGKSVAHNV AAARLDVRAQ FGEAAVLLRA  480
VGDRGGLDLV PVPVDALGCT VEPLQHGAFY YVLV
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.254450.0tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G133972
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G133972_P02
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0557940.0BT055794.1 Zea mays full-length cDNA clone ZM_BFb0196O06 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001288514.10.0WUSCHEL-related homeobox 7-like
SwissprotQ0JKK65e-93WOX7_ORYSJ; WUSCHEL-related homeobox 7
TrEMBLK7V4880.0K7V488_MAIZE; Putative homeobox DNA-binding domain superfamily protein
STRINGGRMZM2G133972_P010.0(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.17e-41homeobox-3