PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G133675_P02
Common Namepco136360, ZEAMMB73_798195
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bHLH
Protein Properties Length: 70aa    MW: 7578.49 Da    PI: 9.2402
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G133675_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH16.51.5e-053766130
                       CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC CS
                HLH  1 rrrahnerErrRRdriNsafeeLrellPka 30
                       +++ + erE+  Rd++N+ f eL ++l ++
  GRMZM2G133675_P02 37 KKTHKAEREKLKRDQLNDLFVELGSMLGSL 66
                       678899*******************99774 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474598.29E-63067IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 70 aa     Download sequence    Send to blast
MVADTESSDS LPGSSNAASE MPANGSIHRK SQEKPPKKTH KAEREKLKRD QLNDLFVELG  60
SMLGSLPGRS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.253201e-104embryo| meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G133675
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G133675_P02
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0881711e-102BT088171.1 Zea mays full-length cDNA clone ZM_BFc0043H09 mRNA, complete cds.
GenBankBT0390271e-102BT039027.1 Zea mays full-length cDNA clone ZM_BFb0351N03 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001140536.13e-37uncharacterized protein LOC100272601
TrEMBLK7UPR52e-44K7UPR5_MAIZE; Putative HLH DNA-binding domain superfamily protein
STRINGGRMZM2G133675_P018e-37(Zea mays)