PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G133331_P04
Common NamebZIP57, LOC107403067, Zm.18774
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 360aa    MW: 39629.1 Da    PI: 6.9067
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G133331_P04genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.73.8e-1174118246
                        XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLk 46 
                        ++ k++rr+++NReAAr+sR RKka+i eLe+   +L+   ++L+
  GRMZM2G133331_P04  74 RDHKAQRRLAQNREAARKSRMRKKAYIVELENSRSKLSHLEQELQ 118
                        5779****************************9999998887665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.8E-970120No hitNo description
SMARTSM003382.8E-873136IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.35875119IPR004827Basic-leucine zipper domain
PfamPF001704.6E-876118IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.34E-877120No hitNo description
PROSITE patternPS0003608095IPR004827Basic-leucine zipper domain
PfamPF141441.9E-28159234IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009074anatomystyle
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MAPLGVAAAD EARFCMTPWS AAAHFENWGD SGIVVTSPLA ETASTDVDMG GGGAMAQSVD  60
GHDNSLPACK VEPRDHKAQR RLAQNREAAR KSRMRKKAYI VELENSRSKL SHLEQELQRA  120
RQQGMFIASG RSGDHGCSTG GALAFDLEYA RWLDEHQHHM NDLRVALSAQ IGDDDLGVLV  180
DGAMLHYDQM FRLKGVATRT DVFHVLSGMW MSPAERFFMW LGGFRSSELL KVLARHVEPL  240
TEQQLVGICG LQQSLQQAED ALSQGMEALQ QALGDTLAAA ATPCAADSVT NYMGQMAVAM  300
SKLATVENFL RQADLLRQQT LKQVRRILTT RQAARALLVI SDYFSRLRAL SSLWLTRPTD
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G133331
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator involved in defense response. {ECO:0000250|UniProtKB:Q7X993}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G133331_P04
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0851450.0BT085145.1 Zea mays full-length cDNA clone ZM_BFb0304K15 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001308277.10.0uncharacterized protein LOC107403067
SwissprotQ5Z6N91e-171TGAL3_ORYSJ; Transcription factor TGAL3
TrEMBLC4J2U80.0C4J2U8_MAIZE; BZIP transcription factor
STRINGGRMZM2G133331_P010.0(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68640.11e-122bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Chern M, et al.
    Interaction specificity and coexpression of rice NPR1 homologs 1 and 3 (NH1 and NH3), TGA transcription factors and Negative Regulator of Resistance (NRR) proteins.
    BMC Genomics, 2014. 15: p. 461
    [PMID:24919709]