PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G133331_P03
Common NameLOC107403067, Zm.18774
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 214aa    MW: 22591.1 Da    PI: 9.3415
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G133331_P03genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.81.7e-11146190246
                        XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLk 46 
                        ++ k++rr+++NReAAr+sR RKka+i eLe+   +L+   ++L+
  GRMZM2G133331_P03 146 RDHKAQRRLAQNREAARKSRMRKKAYIVELENSRSKLSHLEQELQ 190
                        5779****************************9999998887665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1707.5E-10142192No hitNo description
SMARTSM003382.8E-8145208IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.358147191IPR004827Basic-leucine zipper domain
PfamPF001702.1E-8147190IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.32E-8149193No hitNo description
PROSITE patternPS000360152167IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MHRQPSPHAF SSSGSWAEQG AGGYRHGRDG ATFLLPELLQ RSPNPSSKSS SAATFVPPLA  60
AAHGGGVAAP FGMAPLGVAA ADEARFCMTP WSAAAHFENW GDSGIVVTSP LAETASTDVD  120
MGGGGAMAQS VDGHDNSLPA CKVEPRDHKA QRRLAQNREA ARKSRMRKKA YIVELENSRS  180
KLSHLEQELQ RARQQGMFIA SGRSGDHGCS TGGR
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G133331
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator involved in defense response. {ECO:0000250|UniProtKB:Q7X993}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G133331_P03
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0851450.0BT085145.1 Zea mays full-length cDNA clone ZM_BFb0304K15 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001308277.11e-154uncharacterized protein LOC107403067
SwissprotQ5Z6N93e-34TGAL3_ORYSJ; Transcription factor TGAL3
TrEMBLA0A1D6LWH91e-153A0A1D6LWH9_MAIZE; Transcription factor PERIANTHIA
TrEMBLA0A3L6E7J41e-155A0A3L6E7J4_MAIZE; Transcription factor TGAL3
STRINGGRMZM2G133331_P011e-153(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12250.35e-26TGACG motif-binding factor 6
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Chern M, et al.
    Interaction specificity and coexpression of rice NPR1 homologs 1 and 3 (NH1 and NH3), TGA transcription factors and Negative Regulator of Resistance (NRR) proteins.
    BMC Genomics, 2014. 15: p. 461
    [PMID:24919709]