PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G132868_P01
Common NameLOC100283313, ZEAMMB73_451937
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 257aa    MW: 27038.3 Da    PI: 7.5246
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G132868_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_139.51.2e-12178223550
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                        +r++r++kNRe+A rsR RK+a+++eLe  v +Le+e ++L  e e
  GRMZM2G132868_P01 178 QRQKRMIKNRESAARSRDRKQAYVAELESQVMQLEEEQTELLREQE 223
                        89*************************************9987755 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.5E-7174238IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.611176228IPR004827Basic-leucine zipper domain
PfamPF001701.6E-10177224IPR004827Basic-leucine zipper domain
CDDcd147072.47E-17178223No hitNo description
SuperFamilySSF579591.53E-10179227No hitNo description
Gene3DG3DSA:1.20.5.1703.2E-12179228No hitNo description
PROSITE patternPS000360181196IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MASSRVMASS SPPQHAGAGS SSDLARFKSS GVGSMNMDDI IRNIYGPEAV NAAAAESAGL  60
GPAEPSLAAP EAAARRTSEE VWKEISAAGG LPAPVLHIPP AASSGAGARG GGGAAEMTLE  120
DFLARDSCGR AAVMEGNMAL GFPDGDGDAA GSVAGGVGGV RGGGKRALLD PADRAVMQRQ  180
KRMIKNRESA ARSRDRKQAY VAELESQVMQ LEEEQTELLR EQEDRRQKRL KELTERAVPV  240
IRKKSPQDLR RTNSMEW
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.319520.0meristem| ovary| shoot| tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G132868
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00648PBMTransfer from LOC_Os05g36160Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G132868_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9642550.0EU964255.1 Zea mays clone 277330 G-box-binding factor 4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001149687.10.0uncharacterized protein LOC100283313
TrEMBLB6TGZ00.0B6TGZ0_MAIZE; G-box-binding factor 4
STRINGGRMZM2G132868_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26653786
Representative plantOGRP9845410
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.11e-15bZIP family protein
Publications ? help Back to Top
  1. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]