PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G132367_P01
Common NameZm.21359
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family HD-ZIP
Protein Properties Length: 326aa    MW: 35531.4 Da    PI: 4.8525
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G132367_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox581.6e-1871123456
                        -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        ++++  eq+++Le++Fe +++++ ++++++A+ l L+ rqV vWFqNrRa++k
  GRMZM2G132367_P01  71 KRRLALEQVRALERCFETDNKLDPDRKARIARDLALQPRQVAVWFQNRRARWK 123
                        4467789*********************************************9 PP

2HD-ZIP_I/II123.51e-3969161193
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                        ekkrrl+ eqv++LE++Fe+++kL+p+rK+++ar+L lqprqvavWFqnrRAR+ktk lE+d++aL++++dal+++ ++L++++++L++e++
  GRMZM2G132367_P01  69 EKKRRLALEQVRALERCFETDNKLDPDRKARIARDLALQPRQVAVWFQNRRARWKTKTLERDFAALRARHDALRADCDALRRDKDALAAEIR 160
                        69**************************************************************************************9998 PP

        HD-ZIP_I/II  93 e 93 
                        e
  GRMZM2G132367_P01 161 E 161
                        6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.33E-1763125IPR009057Homeodomain-like
SMARTSM003893.6E-1768129IPR001356Homeobox domain
PROSITE profilePS5007115.95369125IPR001356Homeobox domain
CDDcd000864.27E-1570125No hitNo description
PfamPF000469.6E-1671123IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.2E-1977124IPR009057Homeodomain-like
PROSITE patternPS000270100123IPR017970Homeobox, conserved site
PfamPF021832.3E-13125166IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MKRQSKRPTA SRESPETGEK QKLAFAEEEA PPARKVEPDD EAEMDEDEDE LGPGLGGGRA  60
ARSPCGLGEK KRRLALEQVR ALERCFETDN KLDPDRKARI ARDLALQPRQ VAVWFQNRRA  120
RWKTKTLERD FAALRARHDA LRADCDALRR DKDALAAEIR ELRQKLLPKP EATVKLEATT  180
GNDTAEERRQ ATAGAPPAGA CKDGSSDSDS SVVFSDVEAS PYSGGAAFEP PALAGLGAPF  240
LDTSVAPTGC SSPPVFVETK WQQHGPTQYP FPFDSYKACA GYGFTEEWLA SSDLIGSDGG  300
AAGFFSEDHA SSLNFNWCPS GIQGWE
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.213590.0meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G132367
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G132367_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX4699250.0JX469925.1 Zea mays subsp. mays clone UT3181 HB-type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001356593.10.0homeodomain-leucine zipper transcription factor TaHDZipI-1
SwissprotQ10QP31e-100HOX13_ORYSJ; Homeobox-leucine zipper protein HOX13
TrEMBLA0A096S6J00.0A0A096S6J0_MAIZE; HB-type transcription factor
TrEMBLA0A317Y3B20.0A0A317Y3B2_MAIZE; Homeobox-leucine zipper protein HOX13
TrEMBLK4JRN70.0K4JRN7_MAIZE; HB-type transcription factor (Fragment)
STRINGGRMZM2G132367_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Representative plantOGRP1414944
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22430.12e-26homeobox protein 6
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]