PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G131897_P01
Common NameLOC103640511
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Dof
Protein Properties Length: 268aa    MW: 27767.8 Da    PI: 9.1045
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G131897_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof112.91.4e-3550104660
             zf-Dof   6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                         +cprC s++tkfCyynny+++qPr+fC+aCrryWt GG+lrnvPvGg++rk+++
  GRMZM2G131897_P01  50 EQCPRCASRDTKFCYYNNYNTAQPRHFCRACRRYWTLGGSLRNVPVGGSTRKRQR 104
                        68**************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-2243101IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.6850104IPR003851Zinc finger, Dof-type
PfamPF027017.2E-3150104IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105288IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MEAPLHQFPF PVPPPPQPQD ALLQQAVAAR ALMMAGKRAP LQATAAAGRE QCPRCASRDT  60
KFCYYNNYNT AQPRHFCRAC RRYWTLGGSL RNVPVGGSTR KRQRPARPTR AMAAAAATAA  120
TQTATTTACS PFAVSPATML IQGAAGGGLL VSSLLLGSAS ASPLLALGTA PLLEGRLGFD  180
LGLGDAAALA AADGTPGDLA HHHQPLTLGA GPLPWPAATI LEGDRVETTT WKASADVFPF  240
PPAAALWQEL APAVEAGGLH HGAPHLLL
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G131897
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G131897_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6616591e-85AY661659.1 Sorghum bicolor clone BAC 75D9, complete sequence.
GenBankHQ5400841e-85HQ540084.1 Sorghum bicolor clone SbDof1 Dof-type zinc finger protein gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002443463.17e-68dof zinc finger protein DOF1.6
TrEMBLA0A317YCT70.0A0A317YCT7_MAIZE; Dof zinc finger protein MNB1A
STRINGGRMZM2G131897_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.13e-26DOF zinc finger protein 1