PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G131476_P01
Common NameHB121, LOC107275244, Zm.76129
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family HD-ZIP
Protein Properties Length: 262aa    MW: 28241.9 Da    PI: 8.2442
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G131476_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.13.5e-19103157256
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        rk+ +++keq   Le++F+++++++ ++++ LA++l+L+ rqV vWFqNrRa+ k
  GRMZM2G131476_P01 103 RKKLRLSKEQSALLEDHFKEHSTLNPKQKAALARQLNLSPRQVEVWFQNRRARTK 157
                        788899***********************************************98 PP

2HD-ZIP_I/II126.51.2e-40103191190
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                        +kk+rlskeq++lLE++F+e+++L+p++K++lar+L+l+prqv+vWFqnrRARtk+kq+E+d+e Lkr++++l+een+rL++e ++Lr +
  GRMZM2G131476_P01 103 RKKLRLSKEQSALLEDHFKEHSTLNPKQKAALARQLNLSPRQVEVWFQNRRARTKLKQTEVDCEILKRCCETLTEENRRLHRELQQLR-A 191
                        69*************************************************************************************9.3 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.78E-2086160IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-1995162IPR009057Homeodomain-like
PROSITE profilePS5007117.50899159IPR001356Homeobox domain
SMARTSM003891.1E-17101163IPR001356Homeobox domain
PfamPF000461.6E-16103157IPR001356Homeobox domain
CDDcd000861.50E-18103160No hitNo description
PROSITE patternPS000270134157IPR017970Homeobox, conserved site
PfamPF021834.3E-11159192IPR003106Leucine zipper, homeobox-associated
SMARTSM003404.8E-21159202IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006340anatomyadult vascular leaf
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0008019anatomyleaf lamina base
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009074anatomystyle
PO:0020040anatomyleaf base
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025287anatomyseedling coleoptile
PO:0001051developmental stagevascular leaf initiation stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0025574developmental stagevascular leaf differentiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MEQEEVGLAL GLSLGSGHHH QELKPQHPSH PCAALLEPSL SLSGPATKDD GPTAPVRRFA  60
AVKRELQTME GNDDEATGRV LVYSVASSAV VTADDDEGCN SSRKKLRLSK EQSALLEDHF  120
KEHSTLNPKQ KAALARQLNL SPRQVEVWFQ NRRARTKLKQ TEVDCEILKR CCETLTEENR  180
RLHRELQQLR ALSHPHPHPA AFFMPTAAAA ALSICPSCQR LVATGASAAA ATTAGADNKP  240
KAGGPGGRAP HVFSPFTNSA AC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1101107SRKKLRL
2151159RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.761290.0embryo
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G131476
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, stems, leaf blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G131476_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9620300.0EU962030.1 Zea mays clone 239717 homeobox-leucine zipper protein HAT22 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001307477.10.0uncharacterized protein LOC107275244
SwissprotA2Z4C41e-79HOX15_ORYSI; Homeobox-leucine zipper protein HOX15
TrEMBLB6TAL50.0B6TAL5_MAIZE; HB transcription factor
STRINGGRMZM2G131476_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20553698
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.13e-52HD-ZIP family protein
Publications ? help Back to Top
  1. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]