PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G129247_P02
Common NameLOC100279460
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 238aa    MW: 25039.1 Da    PI: 5.4875
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G129247_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.37e-13175220550
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                        +r++r++kNRe+A rsR RK+a+i+eLe  v +Le+   +L  e e
  GRMZM2G129247_P02 175 QRQKRMIKNRESAARSRDRKQAYIAELESQVMQLEEYQAELLTEQE 220
                        89*********************************99988876654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-7171235IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.979173225IPR004827Basic-leucine zipper domain
PfamPF001702.7E-11174220IPR004827Basic-leucine zipper domain
CDDcd147071.11E-16175220No hitNo description
SuperFamilySSF579593.59E-10175225No hitNo description
Gene3DG3DSA:1.20.5.1704.3E-12176224No hitNo description
PROSITE patternPS000360178193IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MASSRVMASS SPPQHAGAGS SSDLARFRSS GGIGSMNMDN IMREIYGPEA VNATVNGRVE  60
PSPAAPEAAA RRTSEEVWKE ISAAGGLSAP VLPPPPAAST GAGARGGGGG ASEMTLEDFL  120
ARDSCAMAAV MEGDMALGFP NCEGDAAGSV AGEAGGGRGS RKRALLDPAD RAVMQRQKRM  180
IKNRESAARS RDRKQAYIAE LESQVMQLEE YQAELLTEQE DRRQKRLKEV NIVFNIIA
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.297440.0endosperm| meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G129247
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the ABA-responsive elements (ABREs) in vitro. Involved in abiotic stress responses and abscisic acid (ABA) signaling (PubMed:20039193). Involved in the signaling pathway that induces growth inhibition in response to D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G129247_P02
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by anoxia, drought, salt stress, oxidative stress, cold and abscisic acid (ABA) (PubMed:20039193). Induced by D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0542760.0BT054276.1 Zea mays full-length cDNA clone ZM_BFb0209M12 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001347900.11e-163uncharacterized protein LOC100279460
SwissprotQ0JHF11e-43BZP12_ORYSJ; bZIP transcription factor 12
TrEMBLB7ZY841e-169B7ZY84_MAIZE; Uncharacterized protein
STRINGGRMZM2G129247_P031e-162(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.11e-15bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]