PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G127537_P01
Common NameHB11, LOC100194027
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family HD-ZIP
Protein Properties Length: 333aa    MW: 36021.3 Da    PI: 7.43
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G127537_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.21.2e-17164218256
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        rk+ +++keq   Le+ F+++ +++ +++  LAk+l+L  rqV vWFqNrRa+ k
  GRMZM2G127537_P01 164 RKKLRLSKEQSAFLEDSFKEHATLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 218
                        788899***********************************************98 PP

2HD-ZIP_I/II1278.3e-41164254192
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                        +kk+rlskeq+++LE+sF+e+ +L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  GRMZM2G127537_P01 164 RKKLRLSKEQSAFLEDSFKEHATLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELSELR-ALK 254
                        69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046185.4E-518133IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.601.4E-17152214IPR009057Homeodomain-like
SuperFamilySSF466892.48E-18155221IPR009057Homeodomain-like
PROSITE profilePS5007116.892160220IPR001356Homeobox domain
SMARTSM003896.2E-16162224IPR001356Homeobox domain
PfamPF000464.8E-15164218IPR001356Homeobox domain
CDDcd000865.93E-16164221No hitNo description
PROSITE patternPS000270195218IPR017970Homeobox, conserved site
SMARTSM003401.7E-24220263IPR003106Leucine zipper, homeobox-associated
PfamPF021831.4E-10220254IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MELALSLGET MADAGRDLML GLGMGVGVRR EEEAQRGRRD REVRRELEFT ARSARSSPEP  60
AVRLTLLHGL GLPWPPPPSS ETNRHLEASA RGFDVNRAPS LSAAGGAAEE DEEQDEAAAA  120
AASSSPNNSA SSFPTDFSAQ GQVAPGADRA CSRASDEDDG GSARKKLRLS KEQSAFLEDS  180
FKEHATLNPK QKLALAKQLN LRPRQVEVWF QNRRARTKLK QTEVDCEYLK RCCETLTEEN  240
RRLQKELSEL RALKTVHPFY MHLPATTLSM CPSCERVASN SAPAPASSPS PATGIAAPAP  300
EQRPSSFAAL FSSPLNRPLA AQAQPQPQAP ANS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1212220RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.91740.0ear| leaf| meristem| ovary| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G127537
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G127537_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0364470.0BT036447.1 Zea mays full-length cDNA clone ZM_BFb0114O05 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001132562.10.0uncharacterized protein LOC100194027
SwissprotQ67UE21e-143HOX11_ORYSJ; Homeobox-leucine zipper protein HOX11
TrEMBLB4FH590.0B4FH59_MAIZE; HB transcription factor
STRINGGRMZM2G127537_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52093363
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.16e-63homeobox from Arabidopsis thaliana