PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G126808_P02
Common NameHB45, LOC100193486
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family HD-ZIP
Protein Properties Length: 296aa    MW: 31434.5 Da    PI: 9.1709
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G126808_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox51.71.5e-16121173254
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
           Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                        rk+ ++tkeq   Le+ F+++++++ +++  LAk+l+L  rqV vWFqNrRa 
  GRMZM2G126808_P02 121 RKKLRLTKEQSALLEDRFKEHSTLNPKQKVALAKQLKLRPRQVEVWFQNRRAS 173
                        788899*********************************************96 PP

2HD-ZIP_I/II114.18.9e-37121214191
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRA....RtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                        +kk+rl+keq++lLE+ F+e+++L+p++Kv+la++L+l+prqv+vWFqnrRA    Rtk+kq+E+d+e Lkr++++l+een+rL++e +eLr
  GRMZM2G126808_P02 121 RKKLRLTKEQSALLEDRFKEHSTLNPKQKVALAKQLKLRPRQVEVWFQNRRAsrarRTKLKQTEVDCELLKRCCESLTEENRRLQRELQELR 212
                        69*************************************************988889**********************************9 PP

        HD-ZIP_I/II  89 eel 91 
                         +l
  GRMZM2G126808_P02 213 -AL 214
                        .55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-17108171IPR009057Homeodomain-like
SuperFamilySSF466891.75E-16114173IPR009057Homeodomain-like
PROSITE profilePS5007116.293117177IPR001356Homeobox domain
SMARTSM003896.0E-14119181IPR001356Homeobox domain
CDDcd000869.57E-14121179No hitNo description
PfamPF000466.2E-14121173IPR001356Homeobox domain
CDDcd146860.00404168213No hitNo description
SMARTSM003402.8E-23181224IPR003106Leucine zipper, homeobox-associated
PfamPF021838.1E-11181215IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MAQEDVHLDD AGLALGLSLG SGSGGASGAA RHGGISRRLS REVRLPSPHP LEPSLTLSLP  60
DEATATGSGG GGAAHSVSSL SVAGVKRERV DDAEGERASS TAALPRACAG AEDDDDDGST  120
RKKLRLTKEQ SALLEDRFKE HSTLNPKQKV ALAKQLKLRP RQVEVWFQNR RASRARRTKL  180
KQTEVDCELL KRCCESLTEE NRRLQRELQE LRALKFAPHP QAPPSSATQA GAAAGVVPAP  240
PPPLYMQMQM PAAATLSLCP SCDRLAGPGA AAKAEPRPKA AATHHFFNPF THSAAC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1119125TRKKLRL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.193120.0endosperm| ovary
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G126808
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G126808_P02
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: In leaves by drought stress. {ECO:0000269|PubMed:17999151}.
UniProtINDUCTION: In leaves by drought stress. {ECO:0000269|PubMed:17999151}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0357540.0BT035754.2 Zea mays full-length cDNA clone ZM_BFb0081O05 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008651466.10.0putative homeobox DNA-binding and leucine zipper domain family protein isoform X1
SwissprotA2XE761e-100HOX19_ORYSI; Homeobox-leucine zipper protein HOX19
SwissprotQ8GRL41e-100HOX19_ORYSJ; Homeobox-leucine zipper protein HOX19
TrEMBLB4FF661e-163B4FF66_MAIZE; Homeobox-leucine zipper protein HAT3
STRINGGRMZM2G126808_P020.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20553698
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.13e-31homeobox from Arabidopsis thaliana