PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G126239_P01
Common NameZm.20799
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family HD-ZIP
Protein Properties Length: 259aa    MW: 28611.8 Da    PI: 9.1501
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G126239_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.52.3e-18113167256
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         k+ +++keq + Lee F+ n++++ +++e LA kl+L  rqV vWFqNrRa+ k
  GRMZM2G126239_P01 113 AKKLRLSKEQSRLLEESFRLNHTLTPKQKEALAVKLKLRPRQVEVWFQNRRARTK 167
                        567789***********************************************98 PP

2HD-ZIP_I/II118.53.6e-38114201289
        HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                        kk+rlskeq++lLEesF+ +++L+p++K++la +L+l+prqv+vWFqnrRARtk+kq+E ++e+Lkr++ +l+een+rL++eveeLr+
  GRMZM2G126239_P01 114 KKLRLSKEQSRLLEESFRLNHTLTPKQKEALAVKLKLRPRQVEVWFQNRRARTKLKQTELECEYLKRCFGSLTEENRRLQREVEELRA 201
                        9*************************************************************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.4E-1993167IPR009057Homeodomain-like
SuperFamilySSF466895.13E-19102170IPR009057Homeodomain-like
PROSITE profilePS5007116.957109169IPR001356Homeobox domain
SMARTSM003891.3E-14111173IPR001356Homeobox domain
CDDcd000869.59E-15112170No hitNo description
PfamPF000461.5E-15113167IPR001356Homeobox domain
PROSITE patternPS000270144167IPR017970Homeobox, conserved site
PfamPF021831.3E-9169202IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.7E-22169212IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MLLLLSNLCL SLLAPLLPPH LPPFLVPVPV HWLAMGSTSP SGLELTMAVP GLSSSSGSEG  60
FGCNNNNGSG NGNNMRDLDM NQPASGGEEE EFPMGSVEEE EDERGGAGGP HRAKKLRLSK  120
EQSRLLEESF RLNHTLTPKQ KEALAVKLKL RPRQVEVWFQ NRRARTKLKQ TELECEYLKR  180
CFGSLTEENR RLQREVEELR AMRVAPPTVL SPHTRQPLPA SALTMCPRCE RITAATAART  240
PRPPPAASPF HPRRPSAAF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1161169RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.207990.0meristem| shoot| tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G126239
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, leaves, nodes, internodes, flowers and embryo. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:17999151}.
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, leaves, nodes, internodes, flowers and embryo. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription repressor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
UniProtProbable transcription repressor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G126239_P01
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9661900.0EU966190.1 Zea mays clone 292384 homeobox-leucine zipper protein ATHB-4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001150230.11e-161uncharacterized protein LOC100283860
SwissprotQ0JKX11e-122HOX3_ORYSJ; Homeobox-leucine zipper protein HOX3
SwissprotQ9XH381e-122HOX3_ORYSI; Homeobox-leucine zipper protein HOX3
TrEMBLA0A060D8N71e-160A0A060D8N7_MAIZE; HB transcription factor (Fragment)
STRINGGRMZM2G126239_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP68263549
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01430.12e-57homeobox-leucine zipper protein 17