PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G125501_P01
Common NameLOC103647799, Zm.153351
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family GRAS
Protein Properties Length: 456aa    MW: 49134.1 Da    PI: 5.2625
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G125501_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3068.9e-94654532373
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn..sseelaalkl..fsevsP 89 
                        ++lL++cA+a++++d++l+q++L+ l+++a pdgd++qRl+a f+ AL ar +r  ++ +ka+++  ++e+   ++++++a++l  f++++P
  GRMZM2G125501_P01  65 EQLLVHCANAIEANDATLTQQILWVLNNIAPPDGDSNQRLTAAFLCALVARASR--TGACKAVTAAVAAESAalHVHRFTAVELagFVDLTP 154
                        79****************************************************..666676655555544445777777777799****** PP

               GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeeleetgerLakfAeelgvpfe 177
                        +++f++ +aN aIlea+eg   vH++ ++ ++++Q p+L++ La+R+egpp lR+T+ + + s        ++ee+g +L +fA++ +v+++
  GRMZM2G125501_P01 155 WHRFGYTAANAAILEAAEGFPVVHVVELGTTHCMQIPTLIDMLATRAEGPPILRLTVADVAPSApppaLDMSYEELGAKLVNFARSRNVSMD 246
                        *********************************************************9886666788778899******************* PP

               GRAS 178 fnvl.......vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles......erdevLklvkslsPkvvvvveqeadhnsesFler 256
                        f+v+        ++ +++l++++L ++  Eal+Vn+++ lh+++de++ +         r+ +Lk +++l P++vvvve++ad ++++ + r
  GRMZM2G125501_P01 247 FRVVptapadaFTSLVNQLRVQQLVLDGSEALVVNCHMLLHTVPDETAGSVGltqpvsLRTMLLKSFRTLDPNLVVVVEEDADFTAGDVVGR 338
                        ****988776555667777888888888****************998766544445557899****************************** PP

               GRAS 257 flealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdg 348
                        +  a+++ +  +d++++ lp+ se+r+++E+e +g++++nv+a+eg er+er+e  ++W +r+++aGF++++++e+aa ++k++l++++  g
  GRMZM2G125501_P01 339 LRAAFNFLWIPYDAVDTFLPKGSEQRRWYEAE-IGWKVENVLAQEGVERVERQEDRGRWGQRMRSAGFRALAFGEEAAGEVKAMLNEHA-AG 428
                        ********************************.********************************************************.88 PP

               GRAS 349 yrveeesgslvlgWkdrpLvsvSaW 373
                        + ++ e++ lvl+Wk++++v++SaW
  GRMZM2G125501_P01 429 WGMKREDDDLVLTWKGHNVVFASAW 453
                        9999********************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098547.3538435IPR005202Transcription factor GRAS
PfamPF035143.1E-9165453IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MMQFTHTAPP PPPLHPNGHA AGVLGLGLFL DVGAPTAARP CPGSFPTPAS KISLGNDLNS  60
TSCMEQLLVH CANAIEANDA TLTQQILWVL NNIAPPDGDS NQRLTAAFLC ALVARASRTG  120
ACKAVTAAVA AESAALHVHR FTAVELAGFV DLTPWHRFGY TAANAAILEA AEGFPVVHVV  180
ELGTTHCMQI PTLIDMLATR AEGPPILRLT VADVAPSAPP PALDMSYEEL GAKLVNFARS  240
RNVSMDFRVV PTAPADAFTS LVNQLRVQQL VLDGSEALVV NCHMLLHTVP DETAGSVGLT  300
QPVSLRTMLL KSFRTLDPNL VVVVEEDADF TAGDVVGRLR AAFNFLWIPY DAVDTFLPKG  360
SEQRRWYEAE IGWKVENVLA QEGVERVERQ EDRGRWGQRM RSAGFRALAF GEEAAGEVKA  420
MLNEHAAGWG MKREDDDLVL TWKGHNVVFA SAWAPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B2e-554245666475Protein SHORT-ROOT
5b3h_B8e-564245612421Protein SHORT-ROOT
5b3h_E8e-564245612421Protein SHORT-ROOT
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G125501
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, leaves and flowers. {ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G125501_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0676930.0BT067693.1 Zea mays full-length cDNA clone ZM_BFc0127K06 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008670530.10.0scarecrow-like protein 32
SwissprotQ9SN221e-163SCL32_ARATH; Scarecrow-like protein 32
TrEMBLA0A1D6F0550.0A0A1D6F055_MAIZE; Scarecrow-like protein 32
STRINGGRMZM2G125501_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56973759
Representative plantOGRP24991534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-148GRAS family protein