PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G123461_P01
Common NameLOC103641032
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family B3
Protein Properties Length: 291aa    MW: 30600.3 Da    PI: 7.6361
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G123461_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B348.61.5e-1521112194
                        EEEE-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTE.EEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
                 B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgr.yvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                        ffkvl     + +  l+lp kfa+    + ++     +l+d++grsW+v+l+ + +  r  + ++GW++Fv+an L +g  +vF++ g  + 
  GRMZM2G123461_P01  21 FFKVL--LPGSFEISLSLPPKFAAGLgVLCPAWRAAAKLRDRTGRSWDVELRRDAGHHRvSFTGGGWRGFVSANALSAGQLLVFEHRG--CL 108
                        77888..444445559*******9888555566678***************66555555455569********************644..54 PP

                        ..EE CS
                 B3  91 elvv 94 
                         + v
  GRMZM2G123461_P01 109 DFAV 112
                        4455 PP

2B337.25.2e-121992661483
                        T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEE CS
                 B3  14 grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFk 83 
                        + l l+k+f+++ g ++ +++ l     sg++W+v +  + + ++ ++ +GW eF+++ngL + D + F 
  GRMZM2G123461_P01 199 RFLDLSKDFCDRVGWSSSRQVVLCAAGDSGKRWQVSV--KVSAKSGMMCAGWAEFAQDNGLTVSDACEFV 266
                        568899*******88888999999999**********..66666666889*****************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019369.42E-1818120IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.4E-1818120IPR015300DNA-binding pseudobarrel domain
CDDcd100171.17E-1719106No hitNo description
SMARTSM010195.1E-1621118IPR003340B3 DNA binding domain
PfamPF023625.8E-1321113IPR003340B3 DNA binding domain
PROSITE profilePS5086312.36557118IPR003340B3 DNA binding domain
SMARTSM010190.44192288IPR003340B3 DNA binding domain
CDDcd100174.91E-8196265No hitNo description
Gene3DG3DSA:2.40.330.101.9E-13197283IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.12E-11199268IPR015300DNA-binding pseudobarrel domain
PfamPF023623.4E-9200266IPR003340B3 DNA binding domain
PROSITE profilePS5086310.532201288IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006340anatomyadult vascular leaf
PO:0006505anatomycentral spike of ear inflorescence
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007022developmental stageseed imbibition stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MASQGVVGGG GGGGGGGRHR FFKVLLPGSF EISLSLPPKF AAGLGVLCPA WRAAAKLRDR  60
TGRSWDVELR RDAGHHRVSF TGGGWRGFVS ANALSAGQLL VFEHRGCLDF AVDRFDASGC  120
CCDDDQDGGG VVVAEHMATT TTTGTEATAD KESGCSGQEA AAAVKRRRRS PLSTTTTVCG  180
GDDNDETLCR RIERAYQLRF LDLSKDFCDR VGWSSSRQVV LCAAGDSGKR WQVSVKVSAK  240
SGMMCAGWAE FAQDNGLTVS DACEFVPPPL HAHGSGSDVL QVHLVRGGGT S
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G123461
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G123461_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008662673.10.0PREDICTED: B3 domain-containing protein Os03g0212300-like
TrEMBLA0A096S0K90.0A0A096S0K9_MAIZE; Uncharacterized protein
STRINGGRMZM2G123461_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP168021012
Representative plantOGRP1612033
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66980.12e-08B3 family protein