PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G122846_P01
Common NamebZIP97, ZEAMMB73_241493, Zm.100290
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 150aa    MW: 16794.8 Da    PI: 9.935
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G122846_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_139.71e-1286132450
                        XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                         +r rr+ +NRe+ArrsR RK++++ eL   v  L + N++L ++l+
  GRMZM2G122846_P01  86 ERRKRRMVSNRESARRSRVRKQKQLSELWAQVVHLRGTNRQLLDQLK 132
                        6899************************************9997665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-783147IPR004827Basic-leucine zipper domain
PfamPF001703.7E-1085132IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.74985132IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.5E-1187133No hitNo description
Gene3DG3DSA:1.20.5.1704.5E-1087132No hitNo description
CDDcd147021.19E-1488131No hitNo description
PROSITE patternPS00036090105IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0008018anatomytransition vascular leaf
PO:0009025anatomyvascular leaf
PO:0009084anatomypericarp
PO:0020040anatomyleaf base
PO:0025142anatomyleaf tip
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MYPAAEIASV RYLSPAAGAA SLRPHYRDDF LFQFQYSDLL LAPAHPSLYQ DVADHLVLGA  60
SFPAAGDNRS SSEESDAYLQ RSLAEERRKR RMVSNRESAR RSRVRKQKQL SELWAQVVHL  120
RGTNRQLLDQ LKCSTVSSET ATVSSVKTPG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
186107RRKRRMVSNRESARRSRVRKQK
299105RRSRVRK
399106RRSRVRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.1002900.0meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G122846
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G122846_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7278690.0KJ727869.1 Zea mays clone pUT5961 bZIP transcription factor (bZIP97) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002454348.16e-55basic leucine zipper 43
TrEMBLA0A3L6F4141e-104A0A3L6F414_MAIZE; Basic leucine zipper 43
TrEMBLK7U0H21e-104K7U0H2_MAIZE; BZIP transcription factor
STRINGGRMZM2G122846_P011e-105(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118635126
Representative plantOGRP31041129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.18e-19basic leucine-zipper 42