PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G122537_P02
Common NameHB82, wox3A, Zm.19184
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family WOX
Protein Properties Length: 258aa    MW: 27466 Da    PI: 7.5806
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G122537_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.94.7e-201877357
                       --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
           Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                       +R+++t+eql +Le++++   r+p+a+++++++++l    +++ ++V++WFqN++a++++
  GRMZM2G122537_P02 18 TRWCPTPEQLMILEDMYRGgLRTPNASQIQQITAHLacygRIEGKNVFYWFQNHKARDRQ 77
                       8*****************99*************************************996 PP

2Wus_type_Homeobox117.75.3e-381778364
  Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       +tRW+PtpeQ++iLe++y+ GlrtPn+++iq+ita+L+ yG+ie+kNVfyWFQN+kaR+rqk
  GRMZM2G122537_P02 17 STRWCPTPEQLMILEDMYRGGLRTPNASQIQQITAHLACYGRIEGKNVFYWFQNHKARDRQK 78
                       79***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003892.4E-41582IPR001356Homeobox domain
SuperFamilySSF466891.28E-101782IPR009057Homeodomain-like
PfamPF000461.2E-171877IPR001356Homeobox domain
CDDcd000863.59E-51879No hitNo description
Gene3DG3DSA:1.10.10.609.0E-71977IPR009057Homeodomain-like
PROSITE profilePS500719.6692378IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008283Biological Processcell proliferation
GO:0009908Biological Processflower development
GO:0009943Biological Processadaxial/abaxial axis specification
GO:0009947Biological Processcentrolateral axis specification
GO:0010865Biological Processstipule development
GO:0048513Biological Processanimal organ development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MPSQQQQQQG QQVAAGSTRW CPTPEQLMIL EDMYRGGLRT PNASQIQQIT AHLACYGRIE  60
GKNVFYWFQN HKARDRQKMR RRLCMSHHLL SCAQYYAAAA HHGHAAFLAA PPPYGHQLLS  120
PSTTSPTPAA AAAAAAAAYG YYYPATAAFA APASRCAGNA TPPSPTTQLF HYQGGGGLVP  180
TEALGRPEYS LGKLDNFGVA LDDVVVSSTS GAVVDTMGAP PVAGFEVAPP LPAAFSCRPL  240
KTLDLFPGGL EEEQHDVA
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.191840.0meristem| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G122537
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G122537_P02
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0401840.0BT040184.1 Zea mays full-length cDNA clone ZM_BFc0070F13 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001106239.10.0putative wuschel homeobox protein
TrEMBLA8Y7V70.0A8Y7V7_MAIZE; HB transcription factor
STRINGGRMZM2G122537_P020.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21773897
Representative plantOGRP55801121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.13e-40WOX family protein
Publications ? help Back to Top
  1. Nardmann J,Zimmermann R,Durantini D,Kranz E,Werr W
    WOX gene phylogeny in Poaceae: a comparative approach addressing leaf and embryo development.
    Mol. Biol. Evol., 2007. 24(11): p. 2474-84
    [PMID:17768306]