PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G119999_P01
Common NameHB127, LOC100273913
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family HD-ZIP
Protein Properties Length: 294aa    MW: 32254.2 Da    PI: 4.5669
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G119999_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.26.6e-1971124356
                        --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        k++++ ++q+++Le+ Fe +++++ e+++++A+ l+L  rqV vWFqNrRa++k
  GRMZM2G119999_P01  71 KKRRLAADQVRALERSFEVDNKLDPERKARIARDLSLHPRQVAVWFQNRRARWK 124
                        4557899**********************************************9 PP

2HD-ZIP_I/II124.45.4e-4070162193
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                        ekkrrl+++qv++LE+sFe ++kL+perK+++ar+L l+prqvavWFqnrRAR+ktkq+E+d++aL+ ++dal+ e ++L++++++L++e+k
  GRMZM2G119999_P01  70 EKKRRLAADQVRALERSFEVDNKLDPERKARIARDLSLHPRQVAVWFQNRRARWKTKQIERDFAALRVRHDALRVECDALRRDKDALAAEIK 161
                        69***************************************************************************************998 PP

        HD-ZIP_I/II  93 e 93 
                        e
  GRMZM2G119999_P01 162 E 162
                        7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.68E-1866128IPR009057Homeodomain-like
PROSITE profilePS5007116.47166126IPR001356Homeobox domain
SMARTSM003896.0E-1969130IPR001356Homeobox domain
CDDcd000861.17E-1671127No hitNo description
PfamPF000463.5E-1671124IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.0E-1977125IPR009057Homeodomain-like
PROSITE patternPS000270101124IPR017970Homeobox, conserved site
PfamPF021837.5E-13126167IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MKRPTSRGSS MVSGQATTDL QEDSCRSMEP HGVDGDATAA AERDDVDAGA YDEEVDEEEE  60
LAGSRGGLGE KKRRLAADQV RALERSFEVD NKLDPERKAR IARDLSLHPR QVAVWFQNRR  120
ARWKTKQIER DFAALRVRHD ALRVECDALR RDKDALAAEI KELRGMVEKQ MEVKLESAAE  180
ELLPVATRSA AAAAVYNKDG STDSDSSAVF NEEASPYPYS GAALDHQQQQ ETSHPLGFTG  240
FTSFLTSSFP SVYHGDSHLD QEADGFFSAA AAGDGFFAEE QSAGIGSWYG GEGW
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1118126RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.57760.0root
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G119999
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G119999_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0420270.0BT042027.1 Zea mays full-length cDNA clone ZM_BFb0113G23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001141777.10.0uncharacterized protein LOC100273913
SwissprotQ338Z72e-94HOX8_ORYSJ; Homeobox-leucine zipper protein HOX8
TrEMBLB4FY390.0B4FY39_MAIZE; HB transcription factor
STRINGGRMZM2G119999_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.12e-33homeobox protein 16
Publications ? help Back to Top
  1. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]