PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G118870_P01
Common NameLOC100280215, ZEAMMB73_587171
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 322aa    MW: 35192.4 Da    PI: 5.9781
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G118870_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_121.16.7e-071872361463
                        HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1  14 ReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                        R + +rsR RK+++i+eLe+ v++L++   +L+ ++++l  +  +l +e+
  GRMZM2G118870_P01 187 RRSGQRSRVRKLQYIAELERTVESLQNIGADLAVRMSSLFHLHNALSMEN 236
                        67889*********************999999988888877777776666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd147034.19E-16186230No hitNo description
Gene3DG3DSA:1.20.5.1704.9E-5187248No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MSRSPHLPPR CPPLGPQITR RDDGMFTQSC RFPSGDTFIG EPPCWLDDLL EDSGKAPKLP  60
PLRRACSDSD AILDALSTFQ SPIYPIEECD LNSGGEAEDL LGGVEGDESG SVVEASCFYG  120
PNSPRQKSRL TTSESSMVNA VLENVPGNPL QYLTIDACSD VNGNVANVTA DACDAFGHPD  180
QDKSFKRRSG QRSRVRKLQY IAELERTVES LQNIGADLAV RMSSLFHLHN ALSMENKQLR  240
IHISSLQQAK LIKDGQTQAL KNEAERLKQM SARHRRSRSV TSCYDLSSFG ADATAVNWQM  300
PDMARLSLNG SSSVSPRSGY GI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1186192RRSGQRS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.60040.0ear| endosperm| meristem| ovary| shoot| tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G118870
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G118870_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0684150.0BT068415.1 Zea mays full-length cDNA clone ZM_BFb0176P14 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008677142.10.0PREDICTED: uncharacterized protein LOC100280215 isoform X1
RefseqXP_008677143.10.0PREDICTED: uncharacterized protein LOC100280215 isoform X1
TrEMBLC0PJE60.0C0PJE6_MAIZE; Putative bZIP transcription factor superfamily protein isoform 1
STRINGGRMZM2G118870_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP973745
MonocotsOGMP81372631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42380.29e-19bZIP family protein