PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G116646_P04
Common Namegpm293
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family YABBY
Protein Properties Length: 185aa    MW: 20855.5 Da    PI: 9.2599
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G116646_P04genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY175.43.5e-54114831170
              YABBY  31 lfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkee...lleelkveeenlksnvekee.sastsvssekl..senedeevpr..vpp 114
                        ++++vtvrCGhC++llsvnl+  ++ l+ ++h  ++ + +   +  +l+++++ +   ++  + s+s+ ++   +  ++ne++ +++    +
  GRMZM2G116646_P04   1 MLNIVTVRCGHCANLLSVNLRALMHSLPEQDHQLQQENIKvhgINGTLHDDHQYCGHLDQLGSsSSSRFRRLPVMcsPQNEQHLLQEqtLNN 92 
                        579***************************98433332224575666666666665554443303333344444454444444333211344 PP

              YABBY 115 virPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                          rPPekrqrvPsaynrfikeei+rika+nPdi hreafs+aaknWah+P+ihfgl
  GRMZM2G116646_P04  93 NARPPEKRQRVPSAYNRFIKEEIRRIKANNPDINHREAFSTAAKNWAHYPNIHFGL 148
                        78****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046906.9E-541148IPR006780YABBY protein
SuperFamilySSF470953.93E-893142IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.109.6E-595142IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MLNIVTVRCG HCANLLSVNL RALMHSLPEQ DHQLQQENIK VHGINGTLHD DHQYCGHLDQ  60
LGSSSSSRFR RLPVMCSPQN EQHLLQEQTL NNNARPPEKR QRVPSAYNRF IKEEIRRIKA  120
NNPDINHREA FSTAAKNWAH YPNIHFGLDD SGREGKKKLV DHEAAASVVA VAAAPTAAKK  180
IQGFY
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.24420.0aerial organ| embryo| endosperm| meristem| ovary| pedicel| pericarp
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G116646
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G116646_P04
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0684090.0BT068409.1 Zea mays full-length cDNA clone ZM_BFb0157I12 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002442565.12e-89hypothetical protein SORBIDRAFT_08g022030
SwissprotQ2QM171e-60YAB6_ORYSJ; Protein YABBY 6
TrEMBLA0A096RWF51e-138A0A096RWF5_MAIZE; Uncharacterized protein
STRINGGRMZM2G116646_P021e-118(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26580.28e-43YABBY family protein