PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G113098_P01
Common NameLOC103637652, Zm.83947
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family GATA
Protein Properties Length: 361aa    MW: 37454.3 Da    PI: 7.7159
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G113098_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.67e-18261295135
               GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                        C++C + kTp+WR gp g+ktLCnaCG+++++ +l
  GRMZM2G113098_P01 261 CTHCASEKTPQWRTGPLGPKTLCNACGVRFKSGRL 295
                        *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.6E-16255305IPR000679Zinc finger, GATA-type
SuperFamilySSF577167.6E-14259319No hitNo description
Gene3DG3DSA:3.30.50.101.8E-13259293IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.227259291IPR000679Zinc finger, GATA-type
CDDcd002022.38E-13260307No hitNo description
PfamPF003201.1E-15261295IPR000679Zinc finger, GATA-type
PROSITE patternPS003440261286IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MASEWEMAMG VELGMGMGTY HYHHNASSIT TAPMSSHHSG GASYSTPHHH HYYGMPPTGG  60
AGDAMRVDDL LDLSTGAGAG AHEFFPTAPA PATTDKGHHH PGAMGEPSPT AANSSDHQTS  120
LLSFADEFYI PSEEAAELEW LSKFVDDSYS DMPNYSSAAA HAAMAAAAAG NGGGGTSAGQ  180
DSCVTAAPAG RGARSKRSSR APAAAAWHSL VSRPPSQPSP SSSSCSSSDF PSSSNRPARG  240
RKSPGPGGDA VAGSDGGVRR CTHCASEKTP QWRTGPLGPK TLCNACGVRF KSGRLVPEYR  300
PAASPTFVLT QHSNSHRKVM ELRRQKELIL IRGSHRDAAA AAGAGSAGPR PELMFRDYGV  360
C
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G113098
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G113098_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9721591e-149EU972159.1 Zea mays clone 376596 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008658338.10.0PREDICTED: GATA transcription factor 2-like
TrEMBLA0A096RTZ70.0A0A096RTZ7_MAIZE; Uncharacterized protein
STRINGGRMZM2G113098_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46212955
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45050.11e-44GATA transcription factor 2