PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G112483_P02
Common Nameumc1448
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 273aa    MW: 30024.8 Da    PI: 10.5835
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G112483_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.44.2e-1077135563
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                        kr++r   NR +A rs +RK  +i+eLe+kv++L+ e ++L  +l +l+     ++se+
  GRMZM2G112483_P02  77 KRAKRILANRQSAARSKERKMRYIAELERKVQTLQLEATTLSAQLAMLQRDTTGMTSEN 135
                        9***********************************************99988888887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.0E-1773137IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.73775138IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.2E-1077131No hitNo description
PfamPF001701.3E-877135IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.14E-1177128No hitNo description
CDDcd147034.17E-2378127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MFEMFLENGG KLPGPPEPSA HPHSTPPRPR HHHSMSMDGS TSLFGSAAAG TPGRSGADAK  60
KAISDAKLAE LALVDPKRAK RILANRQSAA RSKERKMRYI AELERKVQTL QLEATTLSAQ  120
LAMLQRDTTG MTSENSDLKI RVQTMEQQVQ LQDALNDRLR DEIQQLKVAT GQVNASIGKT  180
GNSGMSSFGG NPQSYQRSHI QSLLAAQHLQ RLRIHSQHQQ QQTHFQQQQQ PQPQLLLQEA  240
HPFPVDLKMR GFSLSSHAQN AGASDSHAAK SEP
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G112483
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed at high levels in levels in leaf sheath, moderate levels in leaf blade, but not in roots. Predominantly expressed in vascular tissues. {ECO:0000269|PubMed:14704272, ECO:0000269|PubMed:9311985}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication. {ECO:0000269|PubMed:11390974, ECO:0000269|PubMed:12855676, ECO:0000269|PubMed:14704272, ECO:0000269|PubMed:9311985}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G112483_P02
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0664680.0BT066468.1 Zea mays full-length cDNA clone ZM_BFb0003G23 mRNA, complete cds.
GenBankEU9752860.0EU975286.1 Zea mays clone 486490 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001353704.10.0uncharacterized protein LOC100382174
SwissprotQ69IL42e-69RF2A_ORYSJ; Transcription factor RF2a
TrEMBLA0A1D6E7960.0A0A1D6E796_MAIZE; Putative transcription factor PosF21
STRINGGRMZM2G112483_P010.0(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.12e-63bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Dai S,Zhang Z,Bick J,Beachy RN
    Essential role of the Box II cis element and cognate host factors in regulating the promoter of Rice tungro bacilliform virus.
    J. Gen. Virol., 2006. 87(Pt 3): p. 715-22
    [PMID:16476995]
  3. Liu Y,Dai S,Beachy RN
    Role of the C-terminal domains of rice (Oryza sativa L.) bZIP proteins RF2a and RF2b in regulating transcription.
    Biochem. J., 2007. 405(2): p. 243-9
    [PMID:17371296]
  4. Dai S, et al.
    Transgenic rice plants that overexpress transcription factors RF2a and RF2b are tolerant to rice tungro virus replication and disease.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(52): p. 21012-6
    [PMID:19104064]
  5. Ordiz MI,Yang J,Barbazuk WB,Beachy RN
    Functional analysis of the activation domain of RF2a, a rice transcription factor.
    Plant Biotechnol. J., 2010. 8(7): p. 835-44
    [PMID:20408988]