PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G112483_P01
Common Nameumc1448
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 369aa    MW: 39446.8 Da    PI: 6.275
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G112483_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.86.4e-10173231563
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                        kr++r   NR +A rs +RK  +i+eLe+kv++L+ e ++L  +l +l+     ++se+
  GRMZM2G112483_P01 173 KRAKRILANRQSAARSKERKMRYIAELERKVQTLQLEATTLSAQLAMLQRDTTGMTSEN 231
                        9***********************************************99988888887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.0E-17169233IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.737171234IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.33E-11173227No hitNo description
Gene3DG3DSA:1.20.5.1703.6E-10173227No hitNo description
PfamPF001702.2E-8173231IPR004827Basic-leucine zipper domain
CDDcd147034.50E-25174223No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MDSTPPTDPA ASCLASASAA VASGDVAAML PDSPPRRGAG HRRAQSEILL GGAALPDDLT  60
FDADLGVVGE ACVAGDEDEE DDDDDEEGVG GAGGSRMFEM FLENGGKLPG PPEPSAHPHS  120
TPPRPRHHHS MSMDGSTSLF GSAAAGTPGR SGADAKKAIS DAKLAELALV DPKRAKRILA  180
NRQSAARSKE RKMRYIAELE RKVQTLQLEA TTLSAQLAML QRDTTGMTSE NSDLKIRVQT  240
MEQQVQLQDA LNDRLRDEIQ QLKVATGQVN ASIGKTGNSG MSSFGGNPQS YQRSHIQSLL  300
AAQHLQRLRI HSQHQQQQTH FQQQQQPQPQ LLLQEAHPFP VDLKMRGFSL SSHAQNAGAS  360
DSHAAKSEP
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G112483
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed constitutively at a low level in young seedlings and in roots, stems and leaves of mature plants.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor with an activatory role.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G112483_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0664680.0BT066468.1 Zea mays full-length cDNA clone ZM_BFb0003G23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001353704.10.0uncharacterized protein LOC100382174
SwissprotQ040883e-87POF21_ARATH; Probable transcription factor PosF21
TrEMBLC0PDU90.0C0PDU9_MAIZE; BZIP transcription factor
STRINGGRMZM2G112483_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123022937
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.16e-62bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]